PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do021580.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family HD-ZIP
Protein Properties Length: 359aa    MW: 38447.8 Da    PI: 6.5483
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do021580.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox581.5e-18128180456
                 -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 +++++ eq+++Le+ Fe  +++  e++++LA+ lgL+ rqV +WFqNrRa++k
  Do021580.1 128 KRRLSVEQVRTLERSFEVANKLEPERKAQLARALGLQPRQVAIWFQNRRARWK 180
                 44799***********************************************9 PP

2HD-ZIP_I/II128.43.1e-41126218193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  e+krrls eqv++LE+sFe  +kLeperK++lar+Lglqprqva+WFqnrRAR+ktkqlEkdy++L+r++da ++en++L +++++L++e+++
   Do021580.1 126 ERKRRLSVEQVRTLERSFEVANKLEPERKAQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDVLRRQLDAARAENDALLAHNKKLHAEIMA 218
                  69**************************************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-19103183IPR009057Homeodomain-like
PROSITE profilePS5007116.973122182IPR001356Homeobox domain
SuperFamilySSF466893.47E-19124184IPR009057Homeodomain-like
SMARTSM003892.5E-18125186IPR001356Homeobox domain
CDDcd000863.76E-18127183No hitNo description
PfamPF000468.7E-16128180IPR001356Homeobox domain
PRINTSPR000315.3E-6153162IPR000047Helix-turn-helix motif
PROSITE patternPS000270157180IPR017970Homeobox, conserved site
PRINTSPR000315.3E-6162178IPR000047Helix-turn-helix motif
PfamPF021835.5E-13182221IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MKPMATNGMA PSFFPANFLL QMQQPLPHHA QQQEHHHHHD GHEHEAHHLL APPPPALVSP  60
FLHDFGGAMA APPMLAGGGG LGKRMFPDGV GDDNLNAAAA DPHQDGGAAS DDEEGSAAVG  120
GGCGGERKRR LSVEQVRTLE RSFEVANKLE PERKAQLARA LGLQPRQVAI WFQNRRARWK  180
TKQLEKDYDV LRRQLDAARA ENDALLAHNK KLHAEIMALK GGGGNGGGRQ EAASELINLN  240
VKETEASCSN RSENSSEINL DISRPPTQPP AADESPMNSH RGLPFYASAA IGRADIDQLL  300
HSGHPSPAAV PKMELGHGAT ADTPSATAGG SFGSLLCSGV VVDEQPQFWP WADGHHSFQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1125130ERKRRL
2174182RRARWKTKQ
3219228KGGGGNGGGR
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo021580.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7284121e-162KJ728412.1 Zea mays clone pUT6717 HB transcription factor (HB98) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025796230.10.0homeobox-leucine zipper protein HOX23-like
SwissprotA2Z7344e-93HOX23_ORYSI; Homeobox-leucine zipper protein HOX23
SwissprotQ94GL54e-93HOX23_ORYSJ; Homeobox-leucine zipper protein HOX23
TrEMBLA0A1E5V6C70.0A0A1E5V6C7_9POAL; Homeobox-leucine zipper protein HOX23
STRINGPavir.Ia02126.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22893894
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.14e-63HD-ZIP family protein
Publications ? help Back to Top
  1. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]