PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do021529.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family NAC
Protein Properties Length: 365aa    MW: 39470.7 Da    PI: 9.4413
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do021529.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.64.1e-56221511128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk...k 96 
                 lppGfrFhPtdeel+++yL++k+++ ++++ ++i+evd++k+ePwdLp+k+k +ekewyfFs rd+ky+tg r+nrat++gyWk+tgkdke+++    +
  Do021529.1  22 LPPGFRFHPTDEELITYYLRQKLADGSFTA-RAIAEVDLNKCEPWDLPEKAKLGEKEWYFFSLRDRKYPTGVRTNRATNAGYWKTTGKDKEIYTGqatT 119
                 79*************************999.89***************99999****************************************964444 PP

         NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  elvg+kktLvfykgrap+gekt+Wvmheyrl
  Do021529.1 120 PELVGMKKTLVFYKGRAPRGEKTNWVMHEYRL 151
                 445***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.16E-6419172IPR003441NAC domain
PROSITE profilePS5100561.22322172IPR003441NAC domain
PfamPF023652.3E-2923151IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MSMEGSASGG GGGGGSKKEE SLPPGFRFHP TDEELITYYL RQKLADGSFT ARAIAEVDLN  60
KCEPWDLPEK AKLGEKEWYF FSLRDRKYPT GVRTNRATNA GYWKTTGKDK EIYTGQATTP  120
ELVGMKKTLV FYKGRAPRGE KTNWVMHEYR LHSKSAPKSN KDEWVVCRVF AKSAGAKKYP  180
SNSAHSRSHH HPYTLDMVPP LLPTLLQHDP FVRHHLHPYM TPADLAELAR FARGTPGLHP  240
HIQPHPGKAA AYMNPAVAPP FTLSGGLSLN LGASPAMPSP PLHAMSMAMS QQTAPSGAGG  300
AAGHHHQVMA GDHHQQMAPA GLGGGGCVIA PGADGGFGAD AAGARYQGFD VEQLVDRYWP  360
AGFQV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-572117816171NAC domain-containing protein 19
4dul_A1e-572117816171NAC domain-containing protein 19
1ut7_B1e-572117816171NO APICAL MERISTEM PROTEIN
1ut7_A1e-572117816171NO APICAL MERISTEM PROTEIN
1ut4_B1e-572117816171NO APICAL MERISTEM PROTEIN
1ut4_A1e-572117816171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00277DAPTransfer from AT2G24430Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008652880.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
SwissprotQ9FLJ22e-85NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A096PV360.0A0A096PV36_MAIZE; Uncharacterized protein
STRINGSi030187m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP93613846
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.25e-91NAC domain containing protein 38