PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do021311.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family HD-ZIP
Protein Properties Length: 853aa    MW: 91481 Da    PI: 5.3789
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do021311.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.71.3e-20134189156
                 TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 +++ +++t++q++++e+lF+++++p+ ++r +L+++lgL+ rqVk+WFqNrR+++k
  Do021311.1 134 KKRYHRHTAHQIQQMEALFKECPHPDDKQRLKLSQELGLKPRQVKFWFQNRRTQMK 189
                 688999***********************************************998 PP

2START130.32.2e-413565922206
                 HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS...................SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
       START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskv..................dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                 la +aa+ l k+  a+ep+Wv+ +    g ev+   e ++                    ++e +r+s+vv+m++ +lv  +ld + +W e ++    k
  Do021311.1 356 LAATAADTLAKMCRAGEPLWVRCR--GAGSEVMVADEHARMfswpvdngkqdggsaataARTEGSRDSAVVIMNSITLVDAFLDAN-KWMELFPsivsK 451
                 57889999****************..6666666666666656777788889999****99**************************.************ PP

                 EEEEEEECTT........EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE..TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCEEEEEE CS
       START  79 aetlevissg........galqlmvaelqalsplvp.RdfvfvRyirq.lgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksnghskvtw 166
                 a t++vi+ g        g l lm+ e q++splvp R++vf Ry+   + +g+w +vd   +  q     +ssvv+++++pSg++i++++ng+s+v+w
  Do021311.1 452 ARTIQVINHGassghlgsGSLLLMQGEVQFPSPLVPaREVVFFRYCVHnSDEGTWSVVDFPAEGFQLEALqTSSVVKCQRRPSGCIIQDMPNGYSRVVW 550
                 ************************************************9999*******888888877779**************************** PP

                 EE-EE--SSXX..HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
       START 167 vehvdlkgrlp..hwllrslvksglaegaktwvatlqrqcek 206
                 veh+++ g     h++++  v +g+a+ga +wv+ lqrqce+
  Do021311.1 551 VEHMEMVGDEKplHQVFKDYVANGAAFGATRWVSLLQRQCER 592
                 *****98765449***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.71E-19123192IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.8E-21123185IPR009057Homeodomain-like
PROSITE profilePS5007117.07131191IPR001356Homeobox domain
SMARTSM003891.1E-19132195IPR001356Homeobox domain
CDDcd000866.61E-19134192No hitNo description
PfamPF000463.6E-18134189IPR001356Homeobox domain
PROSITE patternPS000270166189IPR017970Homeobox, conserved site
PROSITE profilePS5084843.03346595IPR002913START domain
SuperFamilySSF559611.07E-28349594No hitNo description
SMARTSM002347.1E-22355592IPR002913START domain
PfamPF018526.5E-34356592IPR002913START domain
CDDcd088751.32E-98366591No hitNo description
Gene3DG3DSA:3.30.530.203.4E-4482558IPR023393START-like domain
SuperFamilySSF559613.02E-15611832No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048497Biological Processmaintenance of floral organ identity
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 853 aa     Download sequence    Send to blast
MFGDCQVLSS MAAMAGASSS ADALFIPNPG ALAGFMSSSA AAMPFHHFSS TAASIIPKEE  60
GGIMGALQVA KDEDMDLEMD MELSGGSGSG HLDGLLSFAD VDDDRPEQKP QHSGLELQPV  120
DAGQQQLATN NGKKKRYHRH TAHQIQQMEA LFKECPHPDD KQRLKLSQEL GLKPRQVKFW  180
FQNRRTQMKA QQDRADNVLL RAENESLKSE NYRLQAAIRN VVCPNCGHAA VLGEMSYEEQ  240
QLRIENARLK DELDRLACIA TRYGGGRQPS MSSALGCLSA PSPVLMAPLD LDMSVYSRHF  300
TDQSSIMGCG DLIQSVLAPP QQIITGGAEH HATSSYMGSM APAPVPEQDR QLVLDLAATA  360
ADTLAKMCRA GEPLWVRCRG AGSEVMVADE HARMFSWPVD NGKQDGGSAA TAARTEGSRD  420
SAVVIMNSIT LVDAFLDANK WMELFPSIVS KARTIQVINH GASSGHLGSG SLLLMQGEVQ  480
FPSPLVPARE VVFFRYCVHN SDEGTWSVVD FPAEGFQLEA LQTSSVVKCQ RRPSGCIIQD  540
MPNGYSRVVW VEHMEMVGDE KPLHQVFKDY VANGAAFGAT RWVSLLQRQC ERIASELARN  600
IADLGGILHY RASGSQSWTA LLESTEDTIR VTTRKNTDPG QPSGVILTAV STSWLPFSHQ  660
QVFELLADEQ QRCQLEILSN GGSLHEVAHI ANGSHPRNCI SLLRVNAASN SSQNVELLLQ  720
ESSTHPDGGS LVVFATVDVD AIQVTMSGED PSYIPLLPLG FAIFPATNPS SAATSASSGN  780
SESSPGNPNE PASGCLLTVG MQVLASAVPS AKLNLSSVTA INSHVCNAIH QITTALKGDG  840
ASRAEPAAVG GSD
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo021311.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ2509860.0AJ250986.2 Zea mays mRNA for OCL4 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025798256.10.0homeobox-leucine zipper protein ROC3
RefseqXP_025798257.10.0homeobox-leucine zipper protein ROC3
SwissprotA2ZAI70.0ROC3_ORYSI; Homeobox-leucine zipper protein ROC3
TrEMBLA0A1E5W1G50.0A0A1E5W1G5_9POAL; Homeobox-leucine zipper protein ROC3
STRINGSi034202m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78463441
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46880.10.0homeobox-7