PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do021222.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family NAC
Protein Properties Length: 348aa    MW: 37314.2 Da    PI: 9.2056
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do021222.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.71.3e-50391631128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 lppGfrFhPtdeelvv+yL+++++g ++++  +i+e+d+yk++Pw+Lp+++  +ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk+v +   + 
  Do021222.1  39 LPPGFRFHPTDEELVVHYLCRRCAGMPISV-PIIAEIDLYKYDPWQLPRMALYGEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKATGADKPVGT--PKP 134
                 79****************************.88***************7666789*************************************99..778 PP

         NAM 100 vglkktLvfykgrapkgektdWvmheyrl 128
                   +kk Lvfy g+apkg kt+W+mheyrl
  Do021222.1 135 LAIKKALVFYAGKAPKGDKTNWIMHEYRL 163
                 9**************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.8E-6134190IPR003441NAC domain
PROSITE profilePS5100559.02739190IPR003441NAC domain
PfamPF023657.7E-2640163IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MVWKRPPAGE INRQEGEEMS GGGGGGGVPA AQSQSSLQLP PGFRFHPTDE ELVVHYLCRR  60
CAGMPISVPI IAEIDLYKYD PWQLPRMALY GEKEWYFFSP RDRKYPNGSR PNRAAGTGYW  120
KATGADKPVG TPKPLAIKKA LVFYAGKAPK GDKTNWIMHE YRLADVDRSA RKKNHSLRLD  180
DWVLCRIYNK KGAAEKPPGA GDGARAITHG GQLAPMGSPP EQKPSVLPPP RAATGAGYTP  240
PTFSELAAYY EVRPSDSMPR AHGGADSSCS GHALAATSTC GVGGGGERPE VQSQPKIAEW  300
ERTFAAGAGP GVNPACSMLG GHHQQLGPAV GGGDPLLQDI LTYWGKPY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-79231961171NO APICAL MERISTEM PROTEIN
1ut4_B1e-79231961171NO APICAL MERISTEM PROTEIN
1ut7_A1e-79231961171NO APICAL MERISTEM PROTEIN
1ut7_B1e-79231961171NO APICAL MERISTEM PROTEIN
4dul_A1e-79231961171NAC domain-containing protein 19
4dul_B1e-79231961171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0373230.0BT037323.1 Zea mays full-length cDNA clone ZM_BFb0162P01 mRNA, complete cds.
GenBankKM9876120.0KM987612.1 Zea mays NAC protein (SNAC052) mRNA, complete cds.
GenBankKJ7279560.0KJ727956.1 Zea mays clone pUT6054 NAC transcription factor (NAC20) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962039.10.0PREDICTED: NAC domain-containing protein 48-like
SwissprotQ7F2L31e-145NAC48_ORYSJ; NAC domain-containing protein 48
TrEMBLK3Z7610.0K3Z761_SETIT; Uncharacterized protein
STRINGSi022381m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34173782
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-116NAC family protein