PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do020747.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family HD-ZIP
Protein Properties Length: 484aa    MW: 51669 Da    PI: 9.1322
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do020747.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.52.6e-1994148256
                 T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 rk+ +++k+q  +Lee+F+ +++++ +++  LA++lgL  rqV vWFqNrRa+ k
  Do020747.1  94 RKKLRLSKDQAAVLEECFKTHHTLTPKQKVALASSLGLRPRQVEVWFQNRRARTK 148
                 778899***********************************************98 PP

2Homeobox59.94.1e-19313367256
                 T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 rk+ +++k+q  +Lee+F+ +++++ +++  LA++lgL  rqV vWFqNrRa+ k
  Do020747.1 313 RKKLRLSKDQAAVLEECFKTHSTLNPKQKVALANRLGLRPRQVEVWFQNRRARTK 367
                 678899***********************************************98 PP

3HD-ZIP_I/II121.93.2e-3994176183
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLeke 83 
                  +kk+rlsk+q+++LEe+F+++++L+p++Kv+la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL ke
   Do020747.1  94 RKKLRLSKDQAAVLEECFKTHHTLTPKQKVALASSLGLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRWCEQLAEENRRLGKE 176
                  69******************************************************************************987 PP

4HD-ZIP_I/II123.78.8e-40313403192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  +kk+rlsk+q+++LEe+F+++++L+p++Kv+la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l++en+rLeke ++Lr +lk
   Do020747.1 313 RKKLRLSKDQAAVLEECFKTHSTLNPKQKVALANRLGLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRWCERLADENKRLEKELADLR-ALK 403
                  69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.4E-1978144IPR009057Homeodomain-like
PROSITE profilePS5007116.56890150IPR001356Homeobox domain
SMARTSM003891.5E-1792154IPR001356Homeobox domain
SuperFamilySSF466895.13E-1892159IPR009057Homeodomain-like
PfamPF000461.6E-1694148IPR001356Homeobox domain
CDDcd000868.94E-1494151No hitNo description
PRINTSPR000314.1E-5121130IPR000047Helix-turn-helix motif
PROSITE patternPS000270125148IPR017970Homeobox, conserved site
PRINTSPR000314.1E-5130146IPR000047Helix-turn-helix motif
SMARTSM003401.5E-13150193IPR003106Leucine zipper, homeobox-associated
PfamPF021833.6E-7150176IPR003106Leucine zipper, homeobox-associated
Gene3DG3DSA:1.10.10.603.6E-18292367IPR009057Homeodomain-like
PROSITE profilePS5007116.633309369IPR001356Homeobox domain
SMARTSM003891.5E-16311373IPR001356Homeobox domain
SuperFamilySSF466898.13E-18311378IPR009057Homeodomain-like
CDDcd000862.07E-13313370No hitNo description
PfamPF000461.9E-16313367IPR001356Homeobox domain
PROSITE patternPS000270344367IPR017970Homeobox, conserved site
SMARTSM003405.2E-21369412IPR003106Leucine zipper, homeobox-associated
PfamPF021832.6E-9369403IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 484 aa     Download sequence    Send to blast
MAPQSLDLGL SLGLGLAALQ PSFCYSGNAA TVVAAAAERE ASPTAAEERE RERRCSPAGS  60
PLSSGSGSGK RAAAERSAGA GSGSGDEDDD GGARKKLRLS KDQAAVLEEC FKTHHTLTPK  120
QKVALASSLG LRPRQVEVWF QNRRARTKLK QTEVDCEYLK RWCEQLAEEN RRLGKEPIEC  180
SFLVSTKTMM PSSLDLGLSL GLTSQGSLSS CTTAGSSGGA ISPWAAAISS VVGDVMMRRD  240
AHAQQQQQHG AAAAAAFDAD HGAMRASTSP DSAAALSSGA SGDNKRDHRE LERSGSGGVR  300
SDEEDGADGS GGRKKLRLSK DQAAVLEECF KTHSTLNPKQ KVALANRLGL RPRQVEVWFQ  360
NRRARTKLKQ TEVDCEYLKR WCERLADENK RLEKELADLR ALKAAPSPAA QPASPAATLT  420
MCPSCRRVAT NHQQQCHPKS KAPAAAAAGN VVPSHCQFFP AAVDRKNQST WNAAAAPLVT  480
RELF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1361369RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
UniProtProbable transcription factor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo020747.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9681200.0EU968120.1 Zea mays clone 314746 homeobox-leucine zipper protein ATHB-4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025811981.11e-141homeobox-leucine zipper protein HOX2-like
SwissprotQ5VPE33e-89HOX2_ORYSJ; Homeobox-leucine zipper protein HOX2
SwissprotQ84U863e-89HOX2_ORYSI; Homeobox-leucine zipper protein HOX2
TrEMBLA0A1E5V6Z00.0A0A1E5V6Z0_9POAL; Homeobox-leucine zipper protein HOX2
STRINGPavir.J26517.1.p1e-142(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38423376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.19e-50homeobox from Arabidopsis thaliana
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]