PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do020692.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GRAS
Protein Properties Length: 560aa    MW: 60167.3 Da    PI: 5.0991
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do020692.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS346.54.5e-1061915603374
        GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn..sseelaalklfsevsPilkfshltaN 99 
                 + Ll+c +  +  d +la   L +++  as dgdp +R+a+yf+ ALa+rla          +ps++s+ +  s+e +  +k++++++P+ kf+hltaN
  Do020692.1 191 QSLLACSRTAA-ADPALAAVELVKVRAAASDDGDPAERVAFYFADALARRLAC-----GGGAQPSTASDAQfaSDELTLCYKTLNDACPYSKFAHLTAN 283
                 67999999655.588999999999****************************8.....223333333333334999999******************** PP

        GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLr 195
                 qaIlea+ +++++Hi+Df+i qG+QW+aLlqaLa+Rpeg+p ++Ri gv sp  g   + +l +t  rL++fA+ lgv+fef + + + +++l+ +++ 
  Do020692.1 284 QAILEATGTATKIHIVDFGIVQGIQWAALLQALATRPEGKPsRVRISGVPSPYLGpkPAASLTATSARLRDFAKLLGVDFEFVP-LLRPVHELDRSDFL 381
                 *************************************887769********998888999************************.599*********** PP

        GRAS 196 vkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgrei 294
                 v+p+Ea+aVn++lql++ll   ++++++ ++vL+l kslsP vv++ e e+++n++ F++rf++al yy  +f+sl++ ++r+s er+ vEr ++g++i
  Do020692.1 382 VEPDEAVAVNFMLQLYHLL---GDSDEPVRRVLRLAKSLSPSVVTLGEYEVSLNRAGFVDRFANALCYYKPVFESLDVAMARDSPERARVERCMFGERI 477
                 *******************...66666777********************************************************************* PP

        GRAS 295 vnvva.cegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslv.lgWkdrpLvsvSaWr 374
                 + +v   egaer+ r+   ++W++ +e +GF+pv+ls++a +qa+ ll +++ +  y++ e   +++ l W++rpL++vSaWr
  Do020692.1 478 RRAVGpEEGAERTDRMAASMEWQMLMEWCGFEPVKLSNYARSQADFLLWNYDaKYKYSLVELPPAFLsLAWEKRPLLTVSAWR 560
                 ****8356899*****************************************88889999*9999988**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF819957.85E-81563No hitNo description
SuperFamilySSF819957.85E-8107157No hitNo description
PROSITE profilePS5098556.136163538IPR005202Transcription factor GRAS
PfamPF035141.5E-103191560IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 560 aa     Download sequence    Send to blast
MAYMCADSGN LMAIAQQVIQ QQQQQQQQHH HHHLPPPPVH LHPRQAPPMP PAAPAPPHGQ  60
IPAASLPYGG GGSAWPHAEH FFSDAFVGAS AADAVFSDLA AATDFDSDVW MDSLIGDPPF  120
ADSDLDRLIF TTPPPPVPVP APSAAAPVDA AAAQPEAAAP ASLPQPAAVA APAACSSPSS  180
LDASCSAPVL QSLLACSRTA AADPALAAVE LVKVRAAASD DGDPAERVAF YFADALARRL  240
ACGGGAQPST ASDAQFASDE LTLCYKTLND ACPYSKFAHL TANQAILEAT GTATKIHIVD  300
FGIVQGIQWA ALLQALATRP EGKPSRVRIS GVPSPYLGPK PAASLTATSA RLRDFAKLLG  360
VDFEFVPLLR PVHELDRSDF LVEPDEAVAV NFMLQLYHLL GDSDEPVRRV LRLAKSLSPS  420
VVTLGEYEVS LNRAGFVDRF ANALCYYKPV FESLDVAMAR DSPERARVER CMFGERIRRA  480
VGPEEGAERT DRMAASMEWQ MLMEWCGFEP VKLSNYARSQ ADFLLWNYDA KYKYSLVELP  540
PAFLSLAWEK RPLLTVSAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A0.01865601375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7270180.0KJ727018.1 Zea mays clone pUT3999 GRAS transcription factor (GRAS55) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002466548.10.0hypothetical protein SORBIDRAFT_01g009740
TrEMBLC5WMW50.0C5WMW5_SORBI; Putative uncharacterized protein Sb01g009740
STRINGSb01g009740.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP85693748
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66770.11e-138GRAS family protein