PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do020566.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family NAC
Protein Properties Length: 147aa    MW: 16504.2 Da    PI: 10.6477
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do020566.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM149.91.3e-46141441128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.k 96 
                 lp+Gf F+Pt+eelv +yLk+k+ g  ++    i++vd+  +ePwdLp k  +++++ ew+fF++ d+ky+ g+r+nr t++gyWkatgkd+ + s+  
  Do020566.1  14 LPVGFCFRPTNEELVRHYLKPKIVGAAHPDLLLIPDVDLSACEPWDLPaKaLIRSNDPEWFFFAPLDRKYPGGHRSNRCTTAGYWKATGKDRLIRSRpA 112
                 799************************999888***************5345666778**************************************989 PP

         NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                 g+l+g+kktLvf++grap+g++t W+mheyr 
  Do020566.1 113 GTLIGVKKTLVFHRGRAPRGHRTAWIMHEYRT 144
                 999***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.81E-5113145IPR003441NAC domain
PROSITE profilePS5100550.27614147IPR003441NAC domain
PfamPF023653.3E-2515143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MPSPPPPPPP PGALPVGFCF RPTNEELVRH YLKPKIVGAA HPDLLLIPDV DLSACEPWDL  60
PAKALIRSND PEWFFFAPLD RKYPGGHRSN RCTTAGYWKA TGKDRLIRSR PAGTLIGVKK  120
TLVFHRGRAP RGHRTAWIMH EYRTAKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-401314719148NAC domain-containing protein 19
3swm_B2e-401314719148NAC domain-containing protein 19
3swm_C2e-401314719148NAC domain-containing protein 19
3swm_D2e-401314719148NAC domain-containing protein 19
3swp_A2e-401314719148NAC domain-containing protein 19
3swp_B2e-401314719148NAC domain-containing protein 19
3swp_C2e-401314719148NAC domain-containing protein 19
3swp_D2e-401314719148NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9532631e-132EU953263.1 Zea mays clone 1394620 mRNA sequence.
GenBankBT0676351e-132BT067635.1 Zea mays full-length cDNA clone ZM_BFc0101L24 mRNA, complete cds.
GenBankKJ7269821e-132KJ726982.1 Zea mays clone pUT3683 NAC transcription factor (NAC117) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002436309.15e-85hypothetical protein SORBIDRAFT_10g000101, partial
RefseqXP_004964250.11e-84PREDICTED: uncharacterized protein LOC101755267 isoform X1
RefseqXP_004964251.11e-84PREDICTED: uncharacterized protein LOC101755267 isoform X2
SwissprotF4JN357e-59NTL9_ARATH; Protein NTM1-like 9
TrEMBLC5Z2126e-85C5Z212_SORBI; Putative uncharacterized protein Sb10g000101 (Fragment)
TrEMBLK3XVZ71e-84K3XVZ7_SETIT; Uncharacterized protein
STRINGSi006105m4e-84(Setaria italica)
STRINGSb10g000101.12e-84(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP134132529
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35580.32e-62NAC transcription factor-like 9