PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do020070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family HD-ZIP
Protein Properties Length: 329aa    MW: 35581.3 Da    PI: 9.459
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do020070.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.11.7e-19179233256
                 T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 rk+ +++k+q  +Lee F+++++++ ++++ LAk+l+L+ rqV vWFqNrRa+ k
  Do020070.1 179 RKKLRLSKDQAAVLEESFKEHNTLNPKQKAALAKQLNLKPRQVEVWFQNRRARTK 233
                 788899***********************************************98 PP

2HD-ZIP_I/II127.55.7e-41179268191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rlsk+q+++LEesF+e+++L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL++ev+eLr +l
   Do020070.1 179 RKKLRLSKDQAAVLEESFKEHNTLNPKQKAALAKQLNLKPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCETLTEENRRLQREVAELR-AL 268
                  69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046185.6E-2614150IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.607.9E-20162229IPR009057Homeodomain-like
SuperFamilySSF466896.27E-19163236IPR009057Homeodomain-like
PROSITE profilePS5007117.281175235IPR001356Homeobox domain
SMARTSM003894.0E-17177239IPR001356Homeobox domain
CDDcd000861.34E-16179236No hitNo description
PfamPF000467.6E-17179233IPR001356Homeobox domain
PROSITE patternPS000270210233IPR017970Homeobox, conserved site
PfamPF021831.3E-10235269IPR003106Leucine zipper, homeobox-associated
SMARTSM003408.8E-23235278IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MEMTVNARDQ EQHGLGLGLS LSLSIATAAP VEPSPPPPPQ QQQQQRAISV APISSHPAPP  60
MMPQPQWWNG AAGLFFSPSS GMDRSVDRKQ QQQLAAVAAC HIHEMPFLRG IDVNRAPAGV  120
IQRGSCSEDE EPAASSPNST LSSLSGKRAA ATRSGDHTPR AGGGGGSDDE DSGAGGGSRK  180
KLRLSKDQAA VLEESFKEHN TLNPKQKAAL AKQLNLKPRQ VEVWFQNRRA RTKLKQTEVD  240
CEFLKRCCET LTEENRRLQR EVAELRALKL VAPHQYARMP PPTTLTMCPS CERLASADEA  300
GRAARPVPTG PWGPVPVRPV FVDGPARRP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1177183SRKKLRL
2227235RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription repressor involved leaf development. Binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. May act as a regulatory switch to specify provascular cell fate. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:10934011, ECO:0000269|PubMed:9076993}.
UniProtProbable transcription repressor involved leaf development. Binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. May act as a regulatory switch to specify provascular cell fate. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:9076993}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo020070.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin and sucrose in primary root apical region. By wounding in leaves. {ECO:0000269|PubMed:10732669}.
UniProtINDUCTION: By auxin and sucrose in primary root apical region. By wounding in leaves. {ECO:0000269|PubMed:10934011}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9424521e-175EU942452.1 Zea mays clone 1503625 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025795353.10.0homeobox-leucine zipper protein HOX1-like
SwissprotQ406911e-86HOX1_ORYSI; Homeobox-leucine zipper protein HOX1
SwissprotQ7XC541e-86HOX1_ORYSJ; Homeobox-leucine zipper protein HOX1
TrEMBLA0A1E5VTL30.0A0A1E5VTL3_9POAL; Homeobox-leucine zipper protein HOX1
STRINGPavir.Ia02217.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25873889
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44910.18e-67homeobox-leucine zipper protein 4
Publications ? help Back to Top
  1. Scarpella E,Boot KJ,Rueb S,Meijer AH
    The procambium specification gene Oshox1 promotes polar auxin transport capacity and reduces its sensitivity toward inhibition.
    Plant Physiol., 2002. 130(3): p. 1349-60
    [PMID:12428000]
  2. Scarpella E,Rueb S,Meijer AH
    The RADICLELESS1 gene is required for vascular pattern formation in rice.
    Development, 2003. 130(4): p. 645-58
    [PMID:12505996]
  3. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]
  4. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  5. Scarpella E,Simons EJ,Meijer AH
    Multiple regulatory elements contribute to the vascular-specific expression of the rice HD-Zip gene Oshox1 in Arabidopsis.
    Plant Cell Physiol., 2005. 46(8): p. 1400-10
    [PMID:15964905]
  6. Meijer AH,Ouwerkerk PB,Hoge JH
    Vectors for transcription factor cloning and target site identification by means of genetic selection in yeast.
    Yeast, 1998. 14(15): p. 1407-15
    [PMID:9848232]