PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do019447.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family NAC
Protein Properties Length: 337aa    MW: 37007.1 Da    PI: 9.5109
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do019447.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.39e-51551791128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 lppGfrFhPtdeelv++yL+++++g ++ +  +i+e+d+yk++Pw+Lp+++  +ekewyfFs+rd+ky++g+r+nra+ sgyWkatg dk+v +   + 
  Do019447.1  55 LPPGFRFHPTDEELVMHYLCRRCAGLPIAV-PIIAEIDLYKFDPWQLPRMALYGEKEWYFFSPRDRKYPNGSRPNRAAGSGYWKATGADKPVGT--PKP 150
                 79**************************99.88***************7666789*************************************99..778 PP

         NAM 100 vglkktLvfykgrapkgektdWvmheyrl 128
                   +kk Lvfy g+apkgekt+W+mheyrl
  Do019447.1 151 LAIKKALVFYAGKAPKGEKTNWIMHEYRL 179
                 9**************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-6151205IPR003441NAC domain
PROSITE profilePS5100559.40555205IPR003441NAC domain
PfamPF023654.8E-2656179IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MRGSAPGTSF KPSSPLPGIS RSSSSSSRRD TGCREQQQRV IERDKMSGGG QDLQLPPGFR  60
FHPTDEELVM HYLCRRCAGL PIAVPIIAEI DLYKFDPWQL PRMALYGEKE WYFFSPRDRK  120
YPNGSRPNRA AGSGYWKATG ADKPVGTPKP LAIKKALVFY AGKAPKGEKT NWIMHEYRLA  180
DVDRSARKKN SLRLDDWVLC RIYNKKGGLE KPPVGAGDRK PAALAAGVSS PPEQKPFVAA  240
PGGLPPAFAD LAAAYYDRPS DSMPRLHADS SCSEQVLSPE QQLAEVQSQP KISEWERTFA  300
SDPVNPAGSL LDPVGHGVGV GGDPLLQDIL MYWGKPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-795221112174Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00121DAPTransfer from AT1G01720Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY7422180.0AY742218.1 Saccharum officinarum NAC23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970815.10.0PREDICTED: NAC domain-containing protein 48
SwissprotQ7F2L31e-172NAC48_ORYSJ; NAC domain-containing protein 48
TrEMBLK3XKJ00.0K3XKJ0_SETIT; Uncharacterized protein
STRINGSi002413m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34173782
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-120NAC family protein