PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do019252.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family TCP
Protein Properties Length: 203aa    MW: 22266.8 Da    PI: 11.7426
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do019252.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP73.46.9e-233186459
         TCP  4 kkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpai 59
                 k++++++hTkv g +  +R+ a+caar+F+L++eL + +d++tieWLlqqa+pa 
  Do019252.1 31 LKRPTKDRHTKVKGCGGQIRMLALCAARVFQLTQELCHNTDGETIEWLLQQAEPAS 86
                589***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136916.6653589IPR017887Transcription factor TCP subgroup
PfamPF036341.7E-193585IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
LALGRCGWRR AAWASGSFGG VKKKTMVPEG LKRPTKDRHT KVKGCGGQIR MLALCAARVF  60
QLTQELCHNT DGETIEWLLQ QAEPASSPPS ALDHPDQLLL PRRVPPLWRL APLLRLPRHV  120
WMELDRTILL ELGLATMERD RGRWQTGMGA GGRQTGTGGR SEGGRGCGRS VGSEFFPLPT  180
RRGSGRIASV RFMGGAGHRI GVW
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo019252.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0718047e-77AB071804.1 Oryza sativa Japonica Group mRNA for transcription factor PCF3, partial cds.
GenBankAC1205397e-77AC120539.4 Oryza sativa Japonica Group cultivar Nipponbare chromosome 11 clone OSJNBb0063D09 map S1559, complete sequence.
GenBankAP0149677e-77AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A1E5VIY41e-142A0A1E5VIY4_9POAL; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28643269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72010.14e-24TCP family protein