PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do019108.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family LBD
Protein Properties Length: 276aa    MW: 28075.4 Da    PI: 7.499
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do019108.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601383.4e-4337134198
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                 +CaaCk+lrrkC++dCv+apyfp ++p+kf  vh++FGasnv+k+l++l++ +reda++sl+yeA++r+rdPvyG+vgvi+ lq++l+q+++ela++ 
  Do019108.1  37 PCAACKFLRRKCQPDCVFAPYFPPDNPQKFVHVHRVFGASNVTKILNELHPYQREDAVNSLAYEADMRLRDPVYGCVGVISILQHRLRQVQQELARAS 134
                 7*********************************************************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.83336137IPR004883Lateral organ boundaries, LOB
PfamPF031952.6E-4337133IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MATSSASSVP PASTGSVITV ASPSTGGSTI SGGTGSPCAA CKFLRRKCQP DCVFAPYFPP  60
DNPQKFVHVH RVFGASNVTK ILNELHPYQR EDAVNSLAYE ADMRLRDPVY GCVGVISILQ  120
HRLRQVQQEL ARASYELSKY QAAAAEATAA SVAVGCNGAA AGMAADFVGN PVPNCTQNFI  180
NVGHSAAASI GGAGFVQHDH FASMQMLAAR SYDGEAATTA IARLGMNGGG GGGYGFGYSS  240
GIGAGHGVVS GLGQISSGQF LKPGTAGGDE QPTAAQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-53311405114LOB family transfactor Ramosa2.1
5ly0_B2e-53311405114LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPromotes the switch from proliferation to differentiation in the embryo sac. Negative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation. Interacts directly with RS2 (rough sheath 2) to repress some knox homeobox genes. {ECO:0000269|PubMed:17209126}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo019108.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY7955601e-136AY795560.1 Triticum aestivum AS2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025808846.11e-141LOB domain-containing protein 6-like
SwissprotQ32SG31e-110LBD6_MAIZE; LOB domain-containing protein 6
TrEMBLA0A1E5V5980.0A0A1E5V598_9POAL; LOB domain-containing protein 6
STRINGSi024114m1e-128(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22673895
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.41e-54LBD family protein