PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do018861.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family MYB
Protein Properties Length: 922aa    MW: 101042 Da    PI: 9.6619
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do018861.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.39.9e-10263306346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +WT++E+++l+  v++ G+++W  Ia t+g++Rt+ qc  r+q 
       Do018861.1 263 AWTAQEEKKLLLIVQEKGMHNWINIAVTLGTHRTPFQCLVRYQR 306
                      8**************************************99995 PP

2Myb_DNA-binding45.12.3e-14315357246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++WT+eEd++l  av+ +G + W ++++ +  gRt++qc +rw+k
       Do018861.1 315 KAWTKEEDLQLQAAVETFGEK-WQLVSASLD-GRTGNQCSNRWRK 357
                      58*******************.*********.***********98 PP

3Myb_DNA-binding35.22.8e-11367411247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      grW   Ed++l   vk+ G+g+W++Ia  ++ gRt  qc +rw++ 
       Do018861.1 367 GRWHLNEDKRLMVSVKLIGSGNWSRIAPFIP-GRTQPQCHERWRNI 411
                      89*****************************.************97 PP

4Myb_DNA-binding39.41.4e-12419463247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      g W +eEd +l+ av ++G+  W++Ia ++  gR +++c  rw+k+
       Do018861.1 419 GEWRPEEDSKLLAAVSEFGSC-WSKIAMKIIPGRNDNMCSRRWNKL 463
                      68*******************.*****99999************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171169257IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.4E-8230268IPR009057Homeodomain-like
PROSITE profilePS500905.227231253IPR017877Myb-like domain
PROSITE profilePS500908.595256308IPR017877Myb-like domain
SMARTSM007179.5E-7260310IPR001005SANT/Myb domain
SuperFamilySSF466891.31E-22262355IPR009057Homeodomain-like
PfamPF002492.3E-7263306IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-12269314IPR009057Homeodomain-like
PROSITE profilePS5129418.483309363IPR017930Myb domain
SMARTSM007171.7E-12313361IPR001005SANT/Myb domain
PfamPF002494.3E-13315357IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-16315361IPR009057Homeodomain-like
CDDcd001671.39E-10316359No hitNo description
PROSITE profilePS500909.942361412IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.602.2E-15363413IPR009057Homeodomain-like
SuperFamilySSF466893.21E-23364460IPR009057Homeodomain-like
SMARTSM007171.3E-7365414IPR001005SANT/Myb domain
PfamPF002492.5E-9367412IPR001005SANT/Myb domain
CDDcd001671.83E-7368412No hitNo description
PROSITE profilePS5129417.638413468IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-16414467IPR009057Homeodomain-like
SMARTSM007172.0E-10417466IPR001005SANT/Myb domain
PfamPF002491.6E-10419463IPR001005SANT/Myb domain
CDDcd001677.81E-10420463No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 922 aa     Download sequence    Send to blast
MDFYSDDSDP DIDEDLREDL DALRRSCILS GADPDAAVAQ VSSGLAGPST PALAAATTTA  60
AAANNGFSSD DDEEEDEDLA LVRSIRENLH RLSNKASPAS PGGGDPSSPR PICTWPPSDT  120
DEDEDDLETL RAIQRRFSHY HSSTSTASPK TMKPEASQGV HSELFEDRND DESFAQKQNA  180
KAPNRTGFPK AALFAIGDFS AVDMAYALTT GAGNFEVTPE SLRSVLPLIS WDKISAMYLA  240
GRSGAECESR WLNSDDPLIN SEAWTAQEEK KLLLIVQEKG MHNWINIAVT LGTHRTPFQC  300
LVRYQRSLNP HILNKAWTKE EDLQLQAAVE TFGEKWQLVS ASLDGRTGNQ CSNRWRKSLH  360
PNRTRVGRWH LNEDKRLMVS VKLIGSGNWS RIAPFIPGRT QPQCHERWRN ILDPNIDLGE  420
WRPEEDSKLL AAVSEFGSCW SKIAMKIIPG RNDNMCSRRW NKLCKHQLPA VKAAIQLKKS  480
VFQTNFVDRE KERPAIAPSD LMSLVQSKGD GSDKNTRGRS KKQTKENLAV SNIVNSSAAP  540
DCVAANTVSN TSSRGPRKST GRRLKNQTEE NVAVPDGLND LSSGRSRSRK RKSTTGSNVA  600
AQKRMRESIP VDNEAVPNEL TGTVSANDDL GTNRMTDPVS VGEEGVVKKR TRRSKPVGSE  660
GAARKRRDAI NADNEAGTDM LRDPVPGEEG VVKKRARRSK PVGSEGAARK RXDXINADNE  720
AGTDMLRDPV PGEEGVVKKK TRRSKPVGSE GAXRKRMDTI NADNEAGTDM MRDDVLGDEG  780
VVKKRTGRSK PVGNKGTARK RMRGSVSVGD EGVGKKGTGS VATENHAGVM KRKRAPSRRK  840
SAEDNLTTEG GANAAPELGL PSVPSEERVV DAGNMDKGRR KSTPRPKQIN MFEGDADKHS  900
TFTRLDNCLS FARMKGINRN KR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C9e-262334723155MYB PROTO-ONCOGENE PROTEIN
1h89_C9e-262334723155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1587592SRKRKS
2647666KKRTRRSKPVGSEGAARKRR
3797803ARKRMRG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660280.10.0PREDICTED: uncharacterized protein LOC101780859
TrEMBLA0A096QN110.0A0A096QN11_MAIZE; Uncharacterized protein
STRINGGRMZM2G051793_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65943543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.21e-105myb domain protein 4r1