PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do018690.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family VOZ
Protein Properties Length: 564aa    MW: 62918.2 Da    PI: 5.0905
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do018690.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ4251.2e-1302654821217
         VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalne.glpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelfdl 98 
                 p+psafl+pkcalwdc+rp+ gse+++dycs++ha+la++e g+pgt+pv+rp+gidlkdg+lfaalsak+qgk+vgip cegaatakspwna+elfdl
  Do018690.1 265 PAPSAFLRPKCALWDCPRPTTGSERWHDYCSMYHADLAVKEeGPPGTMPVIRPRGIDLKDGPLFAALSAKIQGKHVGIPICEGAATAKSPWNAPELFDL 363
                 89*************************************9879******************************************************** PP

         VOZ  99 sllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekksak 197
                  ++ege+irewlffdkprraf+sgnrkqrslpdysgrgwhesrkqvmk+fgglkrsyymdpqps+s+ewhlyeyein++d++alyrle+k++d+kksak
  Do018690.1 364 YIFEGESIREWLFFDKPRRAFDSGNRKQRSLPDYSGRGWHESRKQVMKDFGGLKRSYYMDPQPSNSYEWHLYEYEINDCDTFALYRLEFKSSDAKKSAK 462
                 *************************************************************************************************** PP

         VOZ 198 gkvskdsladlqkklgrlta 217
                 +k+++++l+++q++++rl+a
  Do018690.1 463 SKLACNPLNEIQQQMVRLSA 482
                 ******************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 564 aa     Download sequence    Send to blast
MGKGPSSRAS SRHQQFRARA KTRVDDLQEM FSGLQSARKD SRPADAAVLE AQLQQMLREW  60
RSELSAPSPA SSFQGNIREL SDPPSETLRL LQLAATEEED DATSKLVDQQ EQHAPPPPPP  120
PPPPPANQSQ GHALGCQDMK PEPREESVDV AVAQPQPQPQ PQLLGQGVLP NGAPAAAAVF  180
HDQMYYVNQE LTVEDFLYDD DYKINLSGSN PDVLNNLEGI GPLEYPQFNF PHELPPNAYL  240
DMSNCGQSAG DVFLHMSDLL TTMTPAPSAF LRPKCALWDC PRPTTGSERW HDYCSMYHAD  300
LAVKEEGPPG TMPVIRPRGI DLKDGPLFAA LSAKIQGKHV GIPICEGAAT AKSPWNAPEL  360
FDLYIFEGES IREWLFFDKP RRAFDSGNRK QRSLPDYSGR GWHESRKQVM KDFGGLKRSY  420
YMDPQPSNSY EWHLYEYEIN DCDTFALYRL EFKSSDAKKS AKSKLACNPL NEIQQQMVRL  480
SADSPVDTKR TVRGRTKANP IDVNTNIYSV PSTTVQANVP NAYQAVSQVD QMTYLNGSVV  540
YGPHLPYGYS TERSDFYWNS NDGS
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo018690.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0424030.0BT042403.1 Zea mays full-length cDNA clone ZM_BFb0220N09 mRNA, complete cds.
GenBankEU9710470.0EU971047.1 Zea mays clone 356506 vascular plant one zinc finger protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012702007.10.0transcription factor VOZ1 isoform X1
TrEMBLA0A1E5VWW50.0A0A1E5VWW5_9POAL; Transcription factor VOZ1
STRINGSi000864m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23433888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-147vascular plant one zinc finger protein