PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do018618.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GRAS
Protein Properties Length: 473aa    MW: 52179.3 Da    PI: 4.6366
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do018618.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS55.79.8e-18231287157
        GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsv 57 
                 l++lL++cA+av+s+d + a+++L++++++asp+gd+mqRla++f+e+L+ar+a+++
  Do018618.1 231 LRTLLIHCAQAVASDDRRSATEMLKQIKQHASPQGDAMQRLAHCFAEGLQARVAGTG 287
                 6789*************************************************9855 PP

2GRAS177.69.1e-55292473137316
        GRAS 137 egppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvks 233
                 +gpp++RiTg++ p++g   ++++eetg+rL+k+A+e+gv+f+++v++a+++e+++ e+L+++p+E+l+Vn+++q ++l+desv +es+rd+vL+ +++
  Do018618.1 292 GGPPEVRITGIDLPQPGfrPTQRIEETGRRLSKYAQEFGVSFKYQVIAASKMESIRAEDLNLDPEEVLIVNCIYQFKNLMDESVLIESPRDAVLNNIRK 390
                 79**************9********************************************************************************** PP

        GRAS 234 lsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWr 316
                 ++P+ ++++  + + +++ F++rf eal yysalfd l+++ pr++++r+ +E+ ++gr++ nv+aceg++r+er et+++W+
  Do018618.1 391 MRPHAFIHAIVNGSFSAPFFVTRFREALFYYSALFDVLDTTTPRDNNQRMLIEQNIFGRAALNVIACEGTDRVERPETYKQWQ 473
                 **********************************************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF035143.4E-15231287IPR005202Transcription factor GRAS
PROSITE profilePS5098531.356275473IPR005202Transcription factor GRAS
PfamPF035143.1E-52292473IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 473 aa     Download sequence    Send to blast
MGSSYDPSPS PGSGADDDLF LYLSDLGPTS PSAYLDLPPT PHHEEPQPPE QQQHTQPNGG  60
AGAAAAPEDM VLPFISRMLM EEDIDDKFFY EYPDHPALLQ AQQPFLDILS DDTSSSPTAT  120
THSGSSEEEV VVAAPGGVGV GGGGGRGRKN RFDDEELDFE RSSKQSALQG DGDDRDIFEK  180
YILTSPEMCT EQMEKLRIAM QEEAAKKEAA GGNGKSKAKG SRRGGREVVD LRTLLIHCAQ  240
AVASDDRRSA TEMLKQIKQH ASPQGDAMQR LAHCFAEGLQ ARVAGTGSMV EGGPPEVRIT  300
GIDLPQPGFR PTQRIEETGR RLSKYAQEFG VSFKYQVIAA SKMESIRAED LNLDPEEVLI  360
VNCIYQFKNL MDESVLIESP RDAVLNNIRK MRPHAFIHAI VNGSFSAPFF VTRFREALFY  420
YSALFDVLDT TTPRDNNQRM LIEQNIFGRA ALNVIACEGT DRVERPETYK QWQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-17291473136315GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660358.11e-124PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 9
SwissprotO809331e-73SCL9_ARATH; Scarecrow-like protein 9
TrEMBLK3ZD860.0K3ZD86_SETIT; Uncharacterized protein
STRINGSi024520m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.12e-74GRAS family protein