PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do018432.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family HD-ZIP
Protein Properties Length: 850aa    MW: 90260 Da    PI: 6.2693
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do018432.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox681.2e-21111166156
                 TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 +++ +++t++q++eLe++F+++++p++++r eL+k+l+L+ rqVk+WFqNrR+++k
  Do018432.1 111 KKRYHRHTPQQIQELEAVFKECPHPDEKQRMELSKRLNLESRQVKFWFQNRRTQMK 166
                 688999***********************************************999 PP

2START152.82.8e-483295644205
                 HHHHHHHHHHHHHC-TT-EEEE.......EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEEC CS
       START   4 eeaaqelvkkalaeepgWvkss.......esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevis 86 
                 ++a++el+k  + +ep+W           + +n de+ + f++  +     + +ea r+ gv +  +++lv +l+d + +W+e+++    +a+t++ is
  Do018432.1 329 LAAMEELMKVSQMDEPLWLPTGpdggggfDTLNFDEYSRAFARVFGpspagYVSEATREAGVAITSSVDLVDSLMDAA-RWSEMFPcivaRASTTDIIS 426
                 789****************9989******************775559*******************************.******************** PP

                 TT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE............-TTS--....-TTSEE-EESSEEEEEEEECTCEEE CS
       START  87 sg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvd............seqkppe...sssvvRaellpSgiliepksnghsk 163
                 sg      g +qlm aelq+lsplvp R+++f+R+++q+ +g w++vdvSvd            + q   +    ++++ ++llp+g++++++ ng+sk
  Do018432.1 427 SGmggtrsGSIQLMHAELQVLSPLVPiREVLFLRFCKQHAEGLWAVVDVSVDailrpdggslhqHAQ---NggsAAGYMGCRLLPTGCIVQDMNNGYSK 522
                 ***************************************************9444444444322233...245699*********************** PP

                 EEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
       START 164 vtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                 vtwv h+++++  +h l+r+l++sg+a ga++w+a lqrqc+
  Do018432.1 523 VTWVVHAEYDETAVHHLYRPLLRSGQALGARRWLASLQRQCQ 564
                 *****************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.84E-2293168IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-2398168IPR009057Homeodomain-like
PROSITE profilePS5007118.301108168IPR001356Homeobox domain
SMARTSM003898.7E-20109172IPR001356Homeobox domain
CDDcd000866.56E-20111168No hitNo description
PfamPF000464.0E-19111166IPR001356Homeobox domain
PROSITE patternPS000270143166IPR017970Homeobox, conserved site
PROSITE profilePS5084839.183317568IPR002913START domain
SuperFamilySSF559613.38E-25321564No hitNo description
CDDcd088753.58E-108323564No hitNo description
SMARTSM002348.4E-34326565IPR002913START domain
PfamPF018522.4E-40329564IPR002913START domain
SuperFamilySSF559611.92E-14640840No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 850 aa     Download sequence    Send to blast
MFDGAGSGVF SYDAAATAAA GAGMHNPARL IPAPPLPKPA GFGAPGLSLG LLGDMSRMGL  60
MGGGGSGSAG EGDSLGRGRE DENDSRSGSD NVDGASGDEL DPDNSNPRKK KKRYHRHTPQ  120
QIQELEAVFK ECPHPDEKQR MELSKRLNLE SRQVKFWFQN RRTQMKTQIE RHENALLRQE  180
NDKLRAENMT IREAMRNPIC ASCGGAAVLG EVSLEEQHLR IENARLKDEL DRVCALAGKF  240
LGRPISSGSP MSLQGCSGLE LGVGTNGAFG LGPLGASALQ PLPDLMGAGL PGPVGSAAMR  300
LPAGIGGLDG TMHGAADGID RTVLLELGLA AMEELMKVSQ MDEPLWLPTG PDGGGGFDTL  360
NFDEYSRAFA RVFGPSPAGY VSEATREAGV AITSSVDLVD SLMDAARWSE MFPCIVARAS  420
TTDIISSGMG GTRSGSIQLM HAELQVLSPL VPIREVLFLR FCKQHAEGLW AVVDVSVDAI  480
LRPDGGSLHQ HAQNGGSAAG YMGCRLLPTG CIVQDMNNGY SKVTWVVHAE YDETAVHHLY  540
RPLLRSGQAL GARRWLASLQ RQCQYLAILC SNSLPARDHA AITPVGRRSM LKLAQRMTDN  600
FCAGVCASAA QKWRRLDEWR GNGEGAGSAG NSAAGEGEEK VRMMARQSVG APGEPPGVVL  660
SATTSVRLSA TSPQRVFDYL RDEQRRGEWD ILANGEAMQE MDHIAKGQHH GNAVSLLRPN  720
ATSGNQNNML ILQETCTDSS GSLVVYAPVD VQSMHVVMNG GDSAYVSLLP SGFAILPDGH  780
SQPSNTAQGS PNGQSATNNT GSLVTVAFQI LVNNLPTAKL TVESVETVSN LLSCTIQKIK  840
SALQVSIVTP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1107112RKKKKR
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo018432.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ2509850.0AJ250985.1 Zea mays mRNA for OCL3 protein (ocl3 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025801167.10.0homeobox-leucine zipper protein ROC6-like
SwissprotQ7Y0V70.0ROC6_ORYSJ; Homeobox-leucine zipper protein ROC6
TrEMBLA0A1E5V3Q90.0A0A1E5V3Q9_9POAL; Homeobox-leucine zipper protein ROC6
STRINGSb02g030470.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein