PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do018334.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family G2-like
Protein Properties Length: 359aa    MW: 39308.1 Da    PI: 7.2683
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do018334.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.87.7e-3181134255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 prlrWtpeLH +F++av++LGG+++AtPk +l+lm+vkgL++ hvkSHLQ+YR+
  Do018334.1  81 PRLRWTPELHLCFLRAVDRLGGQDRATPKLVLQLMNVKGLSIGHVKSHLQMYRS 134
                 9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.91577137IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-2977135IPR009057Homeodomain-like
SuperFamilySSF466891.58E-1578135IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-2380136IPR006447Myb domain, plants
PfamPF002497.6E-982133IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MEGSRSKGLD DSSTDHQLPS SGGEAEEEDA AADVPPHAHD GSSSNNSSTV ELDEAGVGDS  60
TRKAGASPSS SVRPYVRSKN PRLRWTPELH LCFLRAVDRL GGQDRATPKL VLQLMNVKGL  120
SIGHVKSHLQ MYRSKKIDES GQVIGGSWPR DHHQLQEGGQ VYKLGHLSLH HGQTGASTIL  180
SARFGTWPHW NNFHQPYWLH SHHLHASKPY YSSAAEADAF LKTHAHQYVS RATSSTPASI  240
LLRCSSSYQN DQSSMNNQRR PLRDEDNNHH DPLDLELALD IRPRRDKRIK RSGCSRGRED  300
EDNAGDQEVE SATDTGLSLS LFSSPPPART SNGSSALGVS MDNAGKAHPT RTSTLDLTI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-1782136357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-1782136357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-1782136357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-1782136357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo018334.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0684401e-100BT068440.1 Zea mays full-length cDNA clone ZM_BFb0191O11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025798662.11e-159putative Myb family transcription factor At1g14600
TrEMBLA0A1E5VA200.0A0A1E5VA20_9POAL; Uncharacterized protein
STRINGSb05g000480.11e-156(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44083671
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-34G2-like family protein