PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do018265.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family HD-ZIP
Protein Properties Length: 309aa    MW: 33827.9 Da    PI: 4.6527
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do018265.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox50.92.6e-1664114656
                 S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 ++  eq+++Le++F  +++++ ++++++A+ lgL+ rqV v FqNrRa++k
  Do018265.1  64 RLALEQVRALERCFDTDNKLDPDRKARIARDLGLQPRQVAVXFQNRRARWK 114
                 57789*********************************************9 PP

2HD-ZIP_I/II115.72.8e-3760152193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  e+krrl+ eqv++LE++F++++kL+p+rK+++ar+Lglqprqvav FqnrRAR+ktk lE+d++aL+++++al+++ ++L+++++ L++e++e
   Do018265.1  60 ERKRRLALEQVRALERCFDTDNKLDPDRKARIARDLGLQPRQVAVXFQNRRARWKTKTLERDFAALRARHEALRADCDALRRDKDVLAAEIRE 152
                  69**************************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003893.9E-1559120IPR001356Homeobox domain
SuperFamilySSF466891.07E-1459116IPR009057Homeodomain-like
PROSITE profilePS5007113.84760116IPR001356Homeobox domain
CDDcd000861.82E-1361116No hitNo description
PfamPF000461.6E-1363114IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.4E-1768115IPR009057Homeodomain-like
PfamPF021838.7E-13116157IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MKRQSKRPAS SHDSTETGEK LAFAEDEALT ARNMEQDDVD DDEDELAGGR AARSACGLGE  60
RKRRLALEQV RALERCFDTD NKLDPDRKAR IARDLGLQPR QVAVXFQNRR ARWKTKTLER  120
DFAALRARHE ALRADCDALR RDKDVLAAEI RELRQKLSKP EVTAVKLEAA GNDAAEERQA  180
TVGASAAAVY KDGSSDSDSS AVFNDVETSP YSGAAFEQPA FLGFGAPPFL DTSAATTGCS  240
SLPLFETKWQ QGPTYPYDSY KTGGGYGITE EWLASSDVIG NDCAASFFSE EHASSLNFGW  300
CATGTEGWE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15964ERKRRL
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo018265.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX4699250.0JX469925.1 Zea mays subsp. mays clone UT3181 HB-type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025798128.11e-167homeobox-leucine zipper protein HOX13-like
SwissprotQ10QP31e-108HOX13_ORYSJ; Homeobox-leucine zipper protein HOX13
TrEMBLA0A1E5VK440.0A0A1E5VK44_9POAL; Homeobox-leucine zipper protein HOX13
STRINGPavir.Ia04906.1.p1e-170(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65310.23e-34homeobox protein 5
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]