PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do018128.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family HD-ZIP
Protein Properties Length: 926aa    MW: 103079 Da    PI: 5.8079
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do018128.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.45.8e-19164215556
                 SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  +ft +q++eLe+ F+++ +p+ e r+eL kk+gL+ rqVk+WFqNrR  ++
  Do018128.1 164 KRFTVQQVQELEAKFQECIHPDPEVRQELGKKIGLEARQVKFWFQNRRSAMR 215
                 57**********************************************9776 PP

2START721.6e-233756303200
                 HHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-SEEEEEEEECTT.... CS
       START   3 aeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetlakaetlevissg.... 88 
                 ae+a +e+  +a+ ++p W         +n+ + l +f+ +        +  ea r++ +  + +++lv+++ d + qW+e+++   ++++++s+    
  Do018128.1 375 AERAFEEFEMLATKDQPIWLWTIdgeMLSNQHYDLHTFPAGLLglcppgFIAEATRETDMIKGSAMDLVSIFTDAA-QWSEMFP--GIVAHVKSNnvis 470
                 678889999999999999999996633345556677776544499999999*************************.*******..5555555555666 PP

                 ............................................EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTS CS
       START  89 ............................................galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssv 142
                                                              ++ +m  e+ + sp  p  ++ f+Ry++ ++  +w++vdvSv  +  ++++ss+
  Do018128.1 471 srgsssrdgmiqlvntharsrkslyvmftfnmidrrrwvglidsVEYLQMDVEFWVQSPRIPtHNVKFLRYSKMMTNRKWAVVDVSVGGNHGVEQESSS 569
                 66999999999999999***************************9****************************************************** PP

                 EE-E...ESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHT CS
       START 143 vRae...llpSgiliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatl 200
                  R++   llpSg+l+e+ks+g +kvtwv h ++ +  ++ l+r++ ++g+a ga +w++ l
  Do018128.1 570 TRCRdywLLPSGCLLEDKSGGFCKVTWVVHGEYLETAVPILFRQFFRTGQAYGACRWLRSL 630
                 ***966679************************************************9866 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF134561.7E-54798No hitNo description
Gene3DG3DSA:1.10.10.604.5E-19147211IPR009057Homeodomain-like
SuperFamilySSF466897.52E-17148215IPR009057Homeodomain-like
PROSITE profilePS5007116.131157217IPR001356Homeobox domain
SMARTSM003891.2E-17160221IPR001356Homeobox domain
CDDcd000864.72E-16161215No hitNo description
PfamPF000461.9E-16164215IPR001356Homeobox domain
PROSITE profilePS5084820.952364639IPR002913START domain
SuperFamilySSF559615.01E-10371475No hitNo description
PfamPF018526.3E-17375630IPR002913START domain
SuperFamilySSF559615.01E-10518632No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 926 aa     Download sequence    Send to blast
LLSGYYGEPG EAEPGEAVGD ENKYIQKQND KLCAENMKLM QELQAKDYNG EVVAAEARWH  60
HHVPDMFTME VLAARDGLLV AVAYGYRRVV LEIDNQALGT MENEWQLNNS NNGQDLGLTM  120
GYDITWNDDV EYNMDDLLGA EDHHVNTDQN SDDENNPPPS KRSKRFTVQQ VQELEAKFQE  180
CIHPDPEVRQ ELGKKIGLEA RQVKFWFQNR RSAMRLKASG NENKDMLKEN TMLRAENEQL  240
KQLRENATCF RCRNPTGENQ QTSEKWRLLV ENARLKDELR RAIAYLNSIT QEQRPHATTS  300
SEHLASSSME PVPLTSQAAL VSHVERAKAY LNSIPLQEER PHAMSSGHQA SAYMDPAVPL  360
TYTCRTNQAT LLSRAERAFE EFEMLATKDQ PIWLWTIDGE MLSNQHYDLH TFPAGLLGLC  420
PPGFIAEATR ETDMIKGSAM DLVSIFTDAA QWSEMFPGIV AHVKSNNVIS SRGSSSRDGM  480
IQLVNTHARS RKSLYVMFTF NMIDRRRWVG LIDSVEYLQM DVEFWVQSPR IPTHNVKFLR  540
YSKMMTNRKW AVVDVSVGGN HGVEQESSST RCRDYWLLPS GCLLEDKSGG FCKVTWVVHG  600
EYLETAVPIL FRQFFRTGQA YGACRWLRSL LRKWEYMAVM HSGGVPRSSS SSGAAISALG  660
KRSVLELAQR MTASFYAAVS GPFTMASANV VDQWCASSGT GAEMLQAAVR MVTWNCAEIM  720
PGEPAITVMS ATSTVWLPGT PPLRVFEYLC NLPRRSEWDI FANGGEVQEL GYVATSERLH  780
GNAVSVLRPT DIADGTNNNM TILQQTSTDA SGSLVVYSLI EENVMRGIML GADNTTTFLL  840
PSGFAILPDG HGKAPYTAAS SSSSVPIGHN NGAGTLLTVA FQSMIMPTSC PSGNLAPVVF  900
DNSGQQLCYA INKIKDAIRA NTIVPV
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo018128.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022684238.10.0homeobox-leucine zipper protein ROC6-like
TrEMBLA0A1E5VII30.0A0A1E5VII3_9POAL; Homeobox-leucine zipper protein ROC6 (Fragment)
STRINGPavir.Ga02048.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP83241742
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.11e-111HD-ZIP family protein