PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do018122.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family G2-like
Protein Properties Length: 256aa    MW: 27272.6 Da    PI: 7.1253
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do018122.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like94.58.6e-30123176155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 +prl+Wtp+LH+rFv++v++L G+++A+Pk i++lm+v+gLt+e+v+SHLQkYRl
  Do018122.1 123 RPRLVWTPQLHKRFVDVVAHL-GIKNAVPKMIMQLMNVEGLTRENVASHLQKYRL 176
                 59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.105120179IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-30120181IPR009057Homeodomain-like
SuperFamilySSF466897.35E-19121180IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-23124176IPR006447Myb domain, plants
PfamPF002493.1E-7126175IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MGEEALDDYD LGCGGGDEER VMEWEMGLPG ADELTPLSQP LVPPGLAAAF RIPPEPGRTL  60
LDVHRASAAT VSRLRRAGSS SSSAVSSFPA WSGGAGGGGA AASARGMMDE ADSSVGGGSN  120
SKRPRLVWTP QLHKRFVDVV AHLGIKNAVP KMIMQLMNVE GLTRENVASH LQKYRLYVKR  180
MQGLSNEGPS PSDHIFASTP VPHSLVHEPQ QVPAPYYHHH VAAAPMGIIS GHGHQYHQNG  240
YGAYPQAAYH HGHADK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A3e-34123179157Transcription factor LUX
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that is essential for the generation of the circadian clock oscillation. Binds to specific sites on CCA1 promoter leading to CCA1 activation (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00014PBMTransfer from AT3G46640Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo018122.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian oscillation with peaks at subjective dusk. {ECO:0000269|PubMed:16164597}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1651726e-84AC165172.2 Zea mays clone CH201-171E16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025817497.11e-113transcription factor PCL1
SwissprotQ94DH31e-92PCL1_ORYSJ; Transcription factor PCL1
TrEMBLA0A1E5UJA80.0A0A1E5UJA8_9POAL; Transcription factor PCL1
STRINGSi002653m1e-108(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP162034105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.33e-62G2-like family protein