PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do017994.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family G2-like
Protein Properties Length: 289aa    MW: 30867.9 Da    PI: 4.9714
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do017994.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.93e-302376255
     G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                +rlrWtp+LH+rFv av+qLGG++kAtPk++l++m v+ Ltl+++kSHLQkYRl
  Do017994.1 23 TRLRWTPQLHNRFVLAVAQLGGADKATPKSVLRAMAVPQLTLYNLKSHLQKYRL 76
                7****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-302080IPR009057Homeodomain-like
SuperFamilySSF466898.42E-162279IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-222377IPR006447Myb domain, plants
PfamPF002491.3E-52475IPR001005SANT/Myb domain
PfamPF143797.4E-16141180IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MSSSDGGGGG GGGQQQQGGE ARTRLRWTPQ LHNRFVLAVA QLGGADKATP KSVLRAMAVP  60
QLTLYNLKSH LQKYRLAVSR GLIANLPGDD GEGPNDRSSS SQSQTDEYDE DAAAKLRSAF  120
AADDGADTEE ALCDSPRSMA RMQREVQRKL QEQIEVQRHL QLRIEAQGRY LQSVLRRAQE  180
VLADHSLGSP AAKAELSELA SAVETGCLSS CSSLSPSPPR HRSADSCVTS SSSEAESQAA  240
AGSKRPCTCT VEQPVQQGKR TFVLQSHDAA EEADEEAEDG SSSEIDLNM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A5e-172277156Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-172277156Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-172277156Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-172277156Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo017994.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0952079e-71FP095207.1 Phyllostachys edulis cDNA clone: bphyem201h10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973515.11e-126myb family transcription factor PHL8
TrEMBLA0A1E5VR890.0A0A1E5VR89_9POAL; Myb-related protein 2
STRINGSi014218m1e-125(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112643038
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.32e-45G2-like family protein