PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do017927.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family NAC
Protein Properties Length: 524aa    MW: 56745.4 Da    PI: 8.3584
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do017927.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM101.61.1e-31101402127
         NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeek.ewyfFskrdkkyatgkrknratk..sgyWkatgkdkevlsk.. 95 
                 p+GfrF+P+deelv++yL ++++g+++  ++++ e+d y ++P +L ++++++ + ewyf s+r++ y +g r++r+t+  +g+Wka+  +kev ++  
  Do017927.1  10 PMGFRFRPKDEELVKYYLLPRLQGRPTVPNDAVVEADAYAFHPDTLTTEHRSGAHgEWYFLSPRSRMYVNGVRPSRKTRdgRGRWKASTATKEVAQEml 108
                 89************************888899**************9655555445********************99955677***********9988 PP

         NAM  96 kgelvglkktLvfykgrapkgektdWvmheyr 127
                 ++  + +k +L +y+g+ ++  +t+W+m e +
  Do017927.1 109 SSGIKFCKGVLNYYEGNPKQEARTKWIMLEIT 140
                 88889***********************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-357170IPR003441NAC domain
PROSITE profilePS5100538.0699170IPR003441NAC domain
PfamPF023654.7E-1710139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 524 aa     Download sequence    Send to blast
MEGDGEKSFP MGFRFRPKDE ELVKYYLLPR LQGRPTVPND AVVEADAYAF HPDTLTTEHR  60
SGAHGEWYFL SPRSRMYVNG VRPSRKTRDG RGRWKASTAT KEVAQEMLSS GIKFCKGVLN  120
YYEGNPKQEA RTKWIMLEIT VPEYEIKLDK PGAAAKNLLD EFVMCKIYVS PQHKKKGEDE  180
DEEEEEEGTS SAYPSSQHMH IQGTAAPRLS EKQARKRPMA ELPPRVRAAP ARKQARQGSL  240
SVGSAQPGCS TSNAASPMMQ VYYAVPGQPL TGAHNGLQPS PMQRQAGAHN VQAPANPPAA  300
GACGGRRLVR MPAPTPVMYT PFSQPTIDDP FGQMATTRLP NQANGNPPRR HPGGTAAFRP  360
QVSLQCSYDQ NYRAASPPGN ASSSRLQSLG AYPPPQQMQQ QPFFNGDANR RGGAAAAAPL  420
GPPNYGFPPP NYGFPYQCNW LTPPEDSHGG AANERNGAAC SNVNAEQYFV DLATMNTSSL  480
PPCPQPQPAP PHLLEPPPPA AAGAAKAETE TGEETSGVNT QDAA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-2121688166Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004959506.10.0PREDICTED: NAC domain-containing protein 71-like
TrEMBLK4A1Y50.0K4A1Y5_SETIT; Uncharacterized protein
STRINGSi032881m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143612024
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.18e-26NAC-like, activated by AP3/PI