PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do017688.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family G2-like
Protein Properties Length: 478aa    MW: 51015 Da    PI: 6.3948
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do017688.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.51.3e-27184238156
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                 k +++WtpeLH+rFveaveqL G++kA+P++ile+m++++Lt+++++SHLQkYR++
  Do017688.1 184 KVKVDWTPELHRRFVEAVEQL-GIDKAVPSRILEIMGIQCLTRHNIASHLQKYRSH 238
                 5689*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.088181240IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-26182241IPR009057Homeodomain-like
SuperFamilySSF466891.06E-17183241IPR009057Homeodomain-like
TIGRFAMsTIGR015573.3E-26184238IPR006447Myb domain, plants
PfamPF002495.6E-7187236IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
MLEVSALRSP SKAADPRGFV GDHVGFPTSG SDCDDCFMVD DNLLLDYIDF SCDVPFFDAD  60
GDILPDLEVD PTELLAEFDG CSGAEAKAPD VKQEAGPEQE QRVTTTIEDD IEKRLLGKDE  120
KKGTNNKQNG DELQGSSAVT TEDDSGSGAG SSDSKSSASA SAGGHSKKKP SATAAGNNSN  180
GKRKVKVDWT PELHRRFVEA VEQLGIDKAV PSRILEIMGI QCLTRHNIAS HLQKYRSHRK  240
HLMAREAEAA TWAQKRQMYA AAAGSAGAPP RKLDAAAAAG PWVVPTIGFP PLPMAQPPPP  300
LCRPLHVWGH PPTTAAVEAA AAAAPAPTML PVWPRHLAPP RPLPPWAPMD PAYWHQQYNA  360
AARKWGPAAA LTQGTPCVAP QMPRFPVPGM VPHPMYRPTM MVPQPPPPPT TSSKLAELQL  420
QLDAHPSKES IDAAIGDVLV KPWLPLPLGL KPPSMDSVMS ELHKQGIPKV PPGQLASG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A3e-15189240657Transcription factor LUX
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional activator that promotes chloroplast development. Acts as an activator of nuclear photosynthetic genes involved in chlorophyll biosynthesis, light harvesting, and electron transport (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo017688.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By light. {ECO:0000269|PubMed:11340194}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3185791e-86AF318579.1 Zea mays putative transcription factor GOLDEN 2 mRNA, complete cds.
GenBankBT0628381e-86BT062838.1 Zea mays full-length cDNA clone ZM_BFb0374G22 mRNA, complete cds.
GenBankEU9533161e-86EU953316.1 Zea mays clone 1398500 transcription factor ZmGLK1 mRNA, complete cds.
GenBankEU9567921e-86EU956792.1 Zea mays clone 1574106 transcription factor ZmGLK1 mRNA, complete cds.
GenBankKJ7276891e-86KJ727689.1 Zea mays clone pUT5628 G2-like transcription factor (GLK13) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025818980.10.0probable transcription factor GLK2 isoform X3
SwissprotQ5NAN51e-125GLK2_ORYSJ; Probable transcription factor GLK2
TrEMBLA0A1E5VGQ40.0A0A1E5VGQ4_9POAL; Putative transcription factor GLK2
STRINGSi001336m1e-175(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24153886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.17e-58GBF's pro-rich region-interacting factor 1
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]