PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do016724.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family WOX
Protein Properties Length: 243aa    MW: 27495.6 Da    PI: 6.9594
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do016724.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.53.1e-201273157
                TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox  1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                ++ R+++t+eq+++L elF+   r+ps+e++++++++l    +++ ++V++WFqN++a+e++
  Do016724.1 12 KCGRWNPTAEQVKVLTELFRAgLRTPSTEQIQRISTHLsafgKVESKNVFYWFQNHKARERH 73
                568*****************99**************************************95 PP

2Wus_type_Homeobox110.41e-351374364
  Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       + RW+Pt+eQ+k+L+el+++GlrtP++e+iqri+++L+++Gk+e+kNVfyWFQN+kaRer++
         Do016724.1 13 CGRWNPTAEQVKVLTELFRAGLRTPSTEQIQRISTHLSAFGKVESKNVFYWFQNHKARERHH 74
                       78**********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003897.6E-41178IPR001356Homeobox domain
PfamPF000461.4E-171373IPR001356Homeobox domain
SuperFamilySSF466891.11E-111477IPR009057Homeodomain-like
CDDcd000864.15E-41575No hitNo description
Gene3DG3DSA:1.10.10.602.8E-71572IPR009057Homeodomain-like
PROSITE profilePS5007110.1061974IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0010078Biological Processmaintenance of root meristem identity
GO:1902459Biological Processpositive regulation of stem cell population maintenance
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MMEALSGRVG VKCGRWNPTA EQVKVLTELF RAGLRTPSTE QIQRISTHLS AFGKVESKNV  60
FYWFQNHKAR ERHHHKKRRR GASSPDSGSG SGSNEEDGRA ASHEAAVEAP DLALQPPESK  120
REARSYGHHH RLLTCKHTRT NALGPELDRE LDHPDVDIDD DRVHAGYVRD VVEQQAAEAL  180
WERPTREVET LDLFPLKSYV DLEAEKVRYV RSSASEQCRE FSFFDVAAGR DPPLELRLCS  240
FGP
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in the specification and maintenance of the stem cells (QC cells) in the root apical meristem (RAM). {ECO:0000269|PubMed:12904206}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo016724.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9697171e-136EU969717.1 Zea mays clone 334641 WUSCHEL-related homeobox 5 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970617.11e-130WUSCHEL-related homeobox 9
SwissprotQ8W0F11e-121WOX9_ORYSJ; WUSCHEL-related homeobox 9
TrEMBLA0A1E5VB091e-179A0A1E5VB09_9POAL; WUSCHEL-related homeobox 9
STRINGPavir.J34036.1.p1e-129(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP94113643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11260.13e-31WUSCHEL related homeobox 5
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Li S, et al.
    OsFIE2 plays an essential role in the regulation of rice vegetative and reproductive development.
    New Phytol., 2014. 201(1): p. 66-79
    [PMID:24020752]
  3. Chu H, et al.
    A CLE-WOX signalling module regulates root meristem maintenance and vascular tissue development in rice.
    J. Exp. Bot., 2013. 64(17): p. 5359-69
    [PMID:24043854]
  4. Wang W, et al.
    Dwarf Tiller1, a Wuschel-related homeobox transcription factor, is required for tiller growth in rice.
    PLoS Genet., 2014. 10(3): p. e1004154
    [PMID:24625559]
  5. Coudert Y, et al.
    Identification of CROWN ROOTLESS1-regulated genes in rice reveals specific and conserved elements of postembryonic root formation.
    New Phytol., 2015. 206(1): p. 243-54
    [PMID:25442012]