PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do016693.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family HD-ZIP
Protein Properties Length: 762aa    MW: 82308.3 Da    PI: 6.0765
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do016693.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.43.8e-2189144156
                 TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 r++ +++t+eq++++e++F+++++p++++r++L+++lgL+ rqVk+WFqNrR++ k
  Do016693.1  89 RKSYHRHTAEQIKAMEAVFKESPHPDEKQRQQLSQELGLSARQVKFWFQNRRTQIK 144
                 788999**********************************************9877 PP

2START171.55.5e-542614881206
                 HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEE CS
       START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.......dsgealrasgvvdmvlallveellddkeqWdetla....kaetlev 84 
                 ela +a+ el ++ +++ep+Wv+s+    + +n+de+++ f++++          +ea+r++gvv  ++++l + ++d++ qW+e ++    ka tl v
  Do016693.1 261 ELAGRALHELTTMCTSGEPLWVRSVetgrDVLNYDEYVRLFQRGDDpgdrragWLVEASRETGVVYHDTTQLANAFMDVN-QWKELFPsmisKAGTLGV 358
                 578999***********************************998889***9999**************************.*******9999******* PP

                 ECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SS CS
       START  85 issg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksnghskvtwvehvdlkgr 175
                 i  g      g++qlm+ae q+l+plvp R+  f+R++++l+a++w++vdvS+d++++  +  s   ++ + pSg+++e+  ng++kvtwveh  +  +
  Do016693.1 359 IHAGenddqdGVVQLMFAEVQMLTPLVPtRELNFLRHCKKLTADKWAVVDVSIDNTEPEAQtASTACKCLKMPSGCIVEEQTNGRCKVTWVEHNTCLNA 457
                 **********************************************************9998999999******************************* PP

                 XXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
       START 176 lphwllrslvksglaegaktwvatlqrqcek 206
                 ++++++r+   +gla+ga++wva+l+ qce+
  Do016693.1 458 VVPSMYRPAAANGLAFGARRWVAALKLQCER 488
                 *****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.0E-2374140IPR009057Homeodomain-like
SuperFamilySSF466894.18E-2077147IPR009057Homeodomain-like
PROSITE profilePS5007118.17286146IPR001356Homeobox domain
SMARTSM003895.5E-1988150IPR001356Homeobox domain
CDDcd000861.28E-1889147No hitNo description
PfamPF000461.3E-1889144IPR001356Homeobox domain
PROSITE patternPS000270121144IPR017970Homeobox, conserved site
PROSITE profilePS5084836.953252491IPR002913START domain
SuperFamilySSF559619.9E-26255488No hitNo description
CDDcd088752.07E-94258487No hitNo description
SMARTSM002341.5E-44261488IPR002913START domain
PfamPF018522.1E-43262488IPR002913START domain
SuperFamilySSF559611.1E-8510686No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010062Biological Processnegative regulation of trichoblast fate specification
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 762 aa     Download sequence    Send to blast
MGSSRPPPRT QDFFPAPALS LSLQAGAFGR NEPAASAGDE VEVGDEGDDG IRLRPGEAAE  60
ISSENTGPGR SQSGGEEAGH EDGGDNKRRK SYHRHTAEQI KAMEAVFKES PHPDEKQRQQ  120
LSQELGLSAR QVKFWFQNRR TQIKATQERH ENSLLKSELE KLQEENRAMR ELVKKSPRCP  180
GCGAATAESN GEEQLRLENA KLKAEIERLR GTPGKTAADE LAAPASPSCS AHAVRTSNRS  240
LADGYGDVVG LLGHDRTRIL ELAGRALHEL TTMCTSGEPL WVRSVETGRD VLNYDEYVRL  300
FQRGDDPGDR RAGWLVEASR ETGVVYHDTT QLANAFMDVN QWKELFPSMI SKAGTLGVIH  360
AGENDDQDGV VQLMFAEVQM LTPLVPTREL NFLRHCKKLT ADKWAVVDVS IDNTEPEAQT  420
ASTACKCLKM PSGCIVEEQT NGRCKVTWVE HNTCLNAVVP SMYRPAAANG LAFGARRWVA  480
ALKLQCERMV FSVATNIPAR DSNGVATLAG RRSVLKLAQR MTSSLCRVIG GSRDLAWSKA  540
SNRGGGHDVR VTSRRNSGDP GEPQGLIACA VLSAWLPVSP AALFDFLRDE SRRHEWDDVM  600
LPGRPVQSCA SVAKGKYRGN CVTAYATKSS AGEQGGEWIL QDSSTNPCEC TVAYAAVDAA  660
ALRSVIDGYD PSGVALLPCG FAVMPDGLES RPAVITSRKE ERDRAAEEAE AGGSLVTVAF  720
QALTGSSPTT DDAPPLDAAE TVAGLASRAL GNIKKALRCE DC
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo016693.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankPNIAATA6e-99D25322.1 Panicum miliaceum gene for cytosolic aspartate aminotransferase, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012701492.10.0homeobox-leucine zipper protein ROC9
SwissprotQ5JMF30.0ROC9_ORYSJ; Homeobox-leucine zipper protein ROC9
TrEMBLA0A1E5VBC30.0A0A1E5VBC3_9POAL; Homeobox-leucine zipper protein ROC9
STRINGSi004904m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79840.10.0HD-ZIP family protein