PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do016360.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family HD-ZIP
Protein Properties Length: 230aa    MW: 25170.5 Da    PI: 9.4503
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do016360.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.61e-1879132356
                 --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 k+ +++keq + Lee F+ n++++ +++e LA kl+L  rqV vWFqNrRa+ k
  Do016360.1  79 KKLRLSKEQSRLLEESFRVNHTLTPKQKEALAVKLKLRPRQVEVWFQNRRARTK 132
                 67789***********************************************98 PP

2HD-ZIP_I/II1201.2e-3879166289
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                  kk+rlskeq++lLEesF+ +++L+p++K++la +L+l+prqv+vWFqnrRARtk+kq+E ++e+Lkr++ +l+een+rL++eveeLr+
   Do016360.1  79 KKLRLSKEQSRLLEESFRVNHTLTPKQKEALAVKLKLRPRQVEVWFQNRRARTKLKQTELECEYLKRCFGSLTEENRRLQREVEELRA 166
                  9*************************************************************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-1864132IPR009057Homeodomain-like
SuperFamilySSF466893.12E-1968135IPR009057Homeodomain-like
PROSITE profilePS5007116.90874134IPR001356Homeobox domain
SMARTSM003892.1E-1576138IPR001356Homeobox domain
CDDcd000864.97E-1577135No hitNo description
PfamPF000467.1E-1679132IPR001356Homeobox domain
PROSITE patternPS000270109132IPR017970Homeobox, conserved site
PfamPF021831.1E-9134167IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.7E-22134177IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MGSTSPSGLE LTMAVPGLSS SSGSEGFGCN AGNGNGSNMR DLDMNQPASG GEEEEFPMGI  60
VEEDEEERGP GAGGPHRPKK LRLSKEQSRL LEESFRVNHT LTPKQKEALA VKLKLRPRQV  120
EVWFQNRRAR TKLKQTELEC EYLKRCFGSL TEENRRLQRE VEELRAMRVA PPTVLSPHTR  180
QPLPASALTM CPRCERITAA TAGAPAGAAR TPRPGAATNP FHPRRPSAAF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1126134RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription repressor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
UniProtProbable transcription repressor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo016360.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0626880.0BT062688.2 Zea mays full-length cDNA clone ZM_BFb0333H18 mRNA, complete cds.
GenBankEU9661900.0EU966190.1 Zea mays clone 292384 homeobox-leucine zipper protein ATHB-4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004969293.11e-130homeobox-leucine zipper protein HOX3
RefseqXP_025819203.11e-129homeobox-leucine zipper protein HOX3-like
SwissprotQ0JKX11e-126HOX3_ORYSJ; Homeobox-leucine zipper protein HOX3
SwissprotQ9XH381e-126HOX3_ORYSI; Homeobox-leucine zipper protein HOX3
TrEMBLA0A1E5W7L81e-165A0A1E5W7L8_9POAL; Homeobox-leucine zipper protein HOX3
STRINGSi002823m1e-129(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP68263549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01430.15e-62homeobox-leucine zipper protein 17