PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do016300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family G2-like
Protein Properties Length: 373aa    MW: 39689.1 Da    PI: 9.0179
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do016300.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.36.2e-32229284156
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                 k+r++W+peLH+rFv a+++LGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Do016300.1 229 KARRCWSPELHRRFVAALQRLGGAQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 284
                 68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.312226286IPR017930Myb domain
SuperFamilySSF466891.72E-17226287IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.5E-29226287IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-26229284IPR006447Myb domain, plants
PfamPF002495.3E-7231282IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MMARKEADQH QLRALAARVV TDSLRAAASR STAAERAARF EDCVRSLEAE KAKMEVFRRE  60
LPISVHLVAD VIEWLKEELA QHRRPAPSAA PAPELFAPAA AKRRAAPEGG AVKAEADAND  120
KRSWMSSAQL WSCGSHDGST ATAAARPAHK VSDAFMPLSG GLPALARSSD DAAEKPTALP  180
VVPDLTLSSP AIDGACPTAP SATSSAVTDG AAAQRQRQHQ QQQAQQQRKA RRCWSPELHR  240
RFVAALQRLG GAQVATPKQI RELMKVDGLT NDEVKSHLQK YRLHTRRASS SDGGDHHQSA  300
AAGLWSGPEQ QYTTSQHSTS QSGSPQGPLQ LTVSSRAMSA TAGDSCDGGD EAEGGRSESY  360
SFGMHHGTKA SSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-13229282154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-13229282154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-13229282154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-13229282154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo016300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963026.11e-178transcription factor HHO3
TrEMBLA0A1E5VCU60.0A0A1E5VCU6_9POAL; Myb family transcription factor EFM
STRINGPavir.J13382.1.p1e-180(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP55823353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.18e-42G2-like family protein