PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do016188.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family WOX
Protein Properties Length: 489aa    MW: 50895.5 Da    PI: 8.0914
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do016188.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox47.33.5e-1555114256
                 T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHH CS
    Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakek 56 
                 r+R+++ +eq+++Le  F++   +p ++e++++  +l     + +++V++WFqNr+ + k
  Do016188.1  55 RPRWNPRPEQIRILEGIFNSgVVNPPRDEIRRIRLQLqeygPVGDANVFYWFQNRKSRTK 114
                 89*****************99****************99999****************99 PP

2Wus_type_Homeobox104.76.1e-3454116264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        +r+RW+P+peQi+iLe +++sG+++P+++ei+ri+ +L+eyG ++d+NVfyWFQNrk+R ++k
         Do016188.1  54 PRPRWNPRPEQIRILEGIFNSGVVNPPRDEIRRIRLQLQEYGPVGDANVFYWFQNRKSRTKHK 116
                        689**********************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.85E-1151119IPR009057Homeodomain-like
PROSITE profilePS500719.83151116IPR001356Homeobox domain
SMARTSM003891.3E-553120IPR001356Homeobox domain
CDDcd000863.21E-654116No hitNo description
Gene3DG3DSA:1.10.10.602.3E-554115IPR009057Homeodomain-like
PfamPF000467.3E-1355115IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009735Biological Processresponse to cytokinin
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0010075Biological Processregulation of meristem growth
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 489 aa     Download sequence    Send to blast
MASSNRHWPS MYRSSLACNF QQPQPDMNNG GGGGGGKASL MSSRCEESGR NPEPRPRWNP  60
RPEQIRILEG IFNSGVVNPP RDEIRRIRLQ LQEYGPVGDA NVFYWFQNRK SRTKHKLRAA  120
GQLQASGRTN LARACAPPPA PAPAPVTPPR HLLASPVAPT SSSSSSSDRS SGSSKSARPA  180
VGLPSPAAAA IQQGVLPATA MDLLSPTPAL AARQLYYHSQ LMAPSMPSIP ELIAASPEPF  240
LLQWQHGGHY LPATELGGVL GAHTHEPAPM HPAAVSPSVL LGLCNEALGQ DYRVDISCSK  300
GLGHGQYWNS SCGSDLSSSN KTDAVSAVIR DDEKARLGLL HYGFGGATAA AAAATSPHLA  360
APVPVQAAAD ANTAMPLPSS APSNAAAATS AAVLTDQLQG LLDAGLGLIG GTPPPSATVV  420
AVARDAVTCA ATATAQFSVP AMRLDVRLAF GEAAVLVRHT GEPVLVDESG VTVEPLQQDS  480
LYYVLMVTK
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo016188.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4902421e-129AM490242.1 Zea mays mRNA for putative wuschel homeobox protein (wox9C gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961209.10.0WUSCHEL-related homeobox 12
SwissprotA3B6V01e-144WOX12_ORYSJ; WUSCHEL-related homeobox 12
TrEMBLA0A1E5VVA20.0A0A1E5VVA2_9POAL; WUSCHEL-related homeobox 12
STRINGSi025013m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26663470
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.15e-33homeobox-3
Publications ? help Back to Top
  1. Cheng CH, et al.
    A fine physical map of the rice chromosome 5.
    Mol. Genet. Genomics, 2005. 274(4): p. 337-45
    [PMID:16261349]