PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do016040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family NAC
Protein Properties Length: 316aa    MW: 34138.9 Da    PI: 8.4755
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do016040.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.32.1e-51131411128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkk.leleev.ikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                 lppGfrFhP+d+el+++yL +k+ gk  ++  +  + +vd++kvePwdLp++++ + +ewyfFs +d+kyatg+r+nrat sgyWkatgkd++v + +g
  Do016040.1  13 LPPGFRFHPRDDELICDYLGPKLGGKVgFSGRRPpMLDVDLNKVEPWDLPAAASVGPREWYFFSLKDRKYATGQRTNRATVSGYWKATGKDRAVAR-RG 110
                 79***********************9986665656***************88888999*************************************9.99 PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 +lvg++ktLvfy+grapkg+kt+Wvmheyr+
  Do016040.1 111 ALVGMRKTLVFYQGRAPKGRKTEWVMHEYRM 141
                 9****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.45E-572166IPR003441NAC domain
PROSITE profilePS5100554.84913166IPR003441NAC domain
PfamPF023652.1E-2614141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MSMSFLSMVE AELPPGFRFH PRDDELICDY LGPKLGGKVG FSGRRPPMLD VDLNKVEPWD  60
LPAAASVGPR EWYFFSLKDR KYATGQRTNR ATVSGYWKAT GKDRAVARRG ALVGMRKTLV  120
FYQGRAPKGR KTEWVMHEYR MEGALEQSSE FSSKDEDWVL CRVICKKKLP GGAGSKASRS  180
LATNGGGHDT APTSSPPLPP LMDTTLAQLQ AAMNNTAGAI EQVPCFSSFN NIASNSNSAA  240
AAAAAQPCYL PMVTGSHGMS FLDHGLPDLG GCGFDPLNCD NKLLKAVLSQ FGGEVVPSLP  300
HEMAAGTATS TWMNHF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-4911671169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0992111e-174FP099211.1 Phyllostachys edulis cDNA clone: bphyem206i06, full insert sequence.
GenBankFP0914231e-174FP091423.1 Phyllostachys edulis cDNA clone: bphyem111l23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963149.10.0PREDICTED: NAC domain-containing protein 21/22-like
TrEMBLK3Z8770.0K3Z877_SETIT; Uncharacterized protein
STRINGSi022747m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP100223144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12977.12e-74NAC family protein