PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do015938.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family TCP
Protein Properties Length: 66aa    MW: 7503.67 Da    PI: 11.8898
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do015938.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP59.81.1e-182066753
         TCP  7 rhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlq 53
                r  ++hTkv+gR+R +R+ a+c ar+  L+  L +++d++t+ WLlq
  Do015938.1 20 RYRDRHTKVEGRGRHIRMAAPCTARVARLTGDLRHKSDGETVRWLLQ 66
                778*******************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136915.5272166IPR017887Transcription factor TCP subgroup
PfamPF036342.8E-142266IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 66 aa     Download sequence    Send to blast
MPVEFLGSGL QLANPRPAPR YRDRHTKVEG RGRHIRMAAP CTARVARLTG DLRHKSDGET  60
VRWLLQ
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681}.
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681, ECO:0000269|PubMed:9338963}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo015938.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0345946e-53BT034594.1 Zea mays full-length cDNA clone ZM_BFb0002D09 mRNA, complete cds.
GenBankKJ7268276e-53KJ726827.1 Zea mays clone pUT3366 TCP transcription factor (TCP19) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957394.17e-35transcription factor PCF2
SwissprotA2YXQ18e-21PCF2_ORYSI; Transcription factor PCF2
SwissprotQ6ZBH68e-21PCF2_ORYSJ; Transcription factor PCF2
TrEMBLA0A1E5V8P15e-41A0A1E5V8P1_9POAL; Uncharacterized protein
STRINGSi030591m2e-34(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39123167
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51910.21e-19TCP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]