PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do015901.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family NAC
Protein Properties Length: 394aa    MW: 42437.4 Da    PI: 7.2952
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do015901.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.91.6e-52111391128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                 +ppGfrFhPt+eel+++yLkkkv++++++l +vi++vd++k+ePwd+++  ++ +  +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk++++ +
  Do015901.1  11 VPPGFRFHPTEEELLTYYLKKKVASERIDL-DVIRDVDLNKLEPWDIQEkcRIGSgPQNDWYFFSHKDKKYPTGTRTNRATTAGFWKATGRDKAIYT-S 107
                 69****************************.9***************952444443456**************************************.8 PP

         NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  + +g++ktLvfykgrap+g+k+dW+mheyrl
  Do015901.1 108 ARRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 139
                 899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-567149IPR003441NAC domain
PROSITE profilePS5100555.9311188IPR003441NAC domain
PfamPF023655.4E-2812139IPR003441NAC domain
SuperFamilySSF1019411.57E-56176188IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MSISVNGQSV VPPGFRFHPT EEELLTYYLK KKVASERIDL DVIRDVDLNK LEPWDIQEKC  60
RIGSGPQNDW YFFSHKDKKY PTGTRTNRAT TAGFWKATGR DKAIYTSARR IGMRKTLVFY  120
KGRAPHGQKS DWIMHEYRLD DATNPSAAAA AGEPYYPSPP PAAAIRGAGG DQAAQEQEGW  180
VICRVFKKKN LLHHGQSSGG ATAAPASASK MAGPMESSPS NCSSVTVSDH VKAAQMLHSA  240
SDDALDHILQ YMGSRPCGNR HQDTKPALMD HHHHLAATTT NTTTACPGSS LYGKFMKLPP  300
LEHAGGGGLL QSPGDYGAAD ASGIADWDTL DRLAAYELNG LSDASKNMAA FFDEPGSAAT  360
VFSSSAHATA ADGDLWSLAR SVSSLHADLT MNNV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-461119015170Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0750800.0KT075080.1 Panicum virgatum secondary wall NAC master switch (SWN1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012701038.10.0PREDICTED: NAC domain-containing protein 43-like
SwissprotQ84WP61e-105NAC43_ARATH; NAC domain-containing protein 43
TrEMBLK3XXA70.0K3XXA7_SETIT; Uncharacterized protein
STRINGSi006565m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP159738112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.18e-89NAC family protein