PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do015448.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GRAS
Protein Properties Length: 634aa    MW: 66482.7 Da    PI: 7.2445
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do015448.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS303.64.9e-932656332373
        GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                 ++lL e+A a+++g++e+a + La l+  a+++gd+ qRl+a+++ AL++r++       ++  +++ +e   +e+ a  +l++++sP+++++  +a  
  Do015448.1 265 RQLLSEAAIAIADGNHEAAATHLAALKRAANQHGDAEQRLIAMMVAALSSRIVP-----TASAXAQHLDELCGAEQRAGSQLLHDISPCFRLALHAASV 358
                 689**************************************************9.....2233333444344777778889****************** PP

        GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg.....skeeleetgerLakfAeelgvpfefnvlvakrledleleeL 194
                 aI+eav  ++++H +Dfd+s   Q +aL+q La+R+ +  sl++T+v +p+s       +++l +++e+L+k+A++ g++ +f+v v+ r ++l+ ++L
  Do015448.1 359 AIVEAVGDHRAIHLVDFDVSF-QQHAALIQYLADRRVPGTSLKVTAVTDPTSPftqspTATTLPAIAEQLKKLADRAGIEYRFKV-VSCRAAELDASRL 455
                 *******************98.7**************************998889999999***********************9.7999********* PP

        GRAS 195 rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgre 293
                  + pgEalaVnl+++l +++desvs +++rde+L+ v+ l P+vvv+veqe+++n++++++rf++a+ +y a+++sl+a+l+r+s e++   ++ l+++
  Do015448.1 456 GCAPGEALAVNLAFALSHVPDESVSPANPRDELLRRVRALGPQVVVLVEQELNTNTAPLAARFTDACAHYGAILESLDATLGRDSAEKKARAEAALAKK 554
                 *************************************************************************************8888888888**** PP

        GRAS 294 ivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                 + n+v  eg +r er+e ++kWr+r+++aGF+p +ls  +a+q+++ +   +  g++v+ ++g l l+W++r ++++SaW
  Do015448.1 555 AANAVGREGPDRLERCEVFGKWRARFGMAGFHPRALSPGIADQVSARVGPAP-PGFTVKADNGVLRLCWMGRVVTVASAW 633
                 ****************************************************.9************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.303238615IPR005202Transcription factor GRAS
PfamPF035141.7E-90265633IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 634 aa     Download sequence    Send to blast
MEPGAPWRDP RQGYATYGGL GSAMQMQLQQ RADAAAGGGV LKRSLGELER WQAQQQQHVA  60
AQQALYLRAV RQRTAAAADI AALLRGGPTP TQQQPLVLPG SSFGGGLASP SSTLSSLTTA  120
SRAAVPLMHP HPQTQRQVPL MTSSPQTQAF GLSRAPPPPQ PAASSELFIL QELEKQLLDD  180
DDDEPVAAMS GTGSAVTNSE WEETIQQLNS ITAAPSPPGL PAAAATPNNN NNGNAGMTRS  240
PSNSTSSTAS SSASCSPPTP GAASRQLLSE AAIAIADGNH EAAATHLAAL KRAANQHGDA  300
EQRLIAMMVA ALSSRIVPTA SAXAQHLDEL CGAEQRAGSQ LLHDISPCFR LALHAASVAI  360
VEAVGDHRAI HLVDFDVSFQ QHAALIQYLA DRRVPGTSLK VTAVTDPTSP FTQSPTATTL  420
PAIAEQLKKL ADRAGIEYRF KVVSCRAAEL DASRLGCAPG EALAVNLAFA LSHVPDESVS  480
PANPRDELLR RVRALGPQVV VLVEQELNTN TAPLAARFTD ACAHYGAILE SLDATLGRDS  540
AEKKARAEAA LAKKAANAVG REGPDRLERC EVFGKWRARF GMAGFHPRAL SPGIADQVSA  600
RVGPAPPGFT VKADNGVLRL CWMGRVVTVA SAWH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-3228363422375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976581.10.0PREDICTED: scarecrow-like protein 8
TrEMBLK3Y5W20.0K3Y5W2_SETIT; Uncharacterized protein
STRINGSi009601m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.11e-85SCARECROW-like 8