PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do015330.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family NAC
Protein Properties Length: 413aa    MW: 44151.4 Da    PI: 8.696
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do015330.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.37.4e-50441692128
         NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                 +pGfrFhPt+eel+ +yL++kvegk++++ e i+ +d+y+++Pw+Lp++++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ + +++++ +
  Do015330.1  44 MPGFRFHPTEEELIEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPAMAAIGEKEWFFYVPRDRKYRNGDRPNRVTASGYWKATGADRMIRAENNRPI 141
                 79***************************.89***************888889********************************************** PP

         NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
                 glkktLvfy+g+apkg++++W+m+eyrl
  Do015330.1 142 GLKKTLVFYSGKAPKGVRSSWIMNEYRL 169
                 **************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.1E-5643189IPR003441NAC domain
PROSITE profilePS5100555.3943190IPR003441NAC domain
PfamPF023651.4E-2445169IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MSGRHENGHG AAAAAAAAAA AVGGGGGGRA GDGDGDAHED DLVMPGFRFH PTEEELIEFY  60
LRRKVEGKRF NVELITFLDL YRYDPWELPA MAAIGEKEWF FYVPRDRKYR NGDRPNRVTA  120
SGYWKATGAD RMIRAENNRP IGLKKTLVFY SGKAPKGVRS SWIMNEYRLP PDDTDRYHKT  180
EISLCRVYKR TGIDDGHGHG HPSSARSTPS RGGATAQQAD IKQASSSSTP TPPTTPSKMM  240
HLLHGECTSP PAIKDHAAAH NKPAAAQRQL PTKPCNGGYL LSTASSATAA AGDPLQVGTT  300
AMPSSYEQSR NASAFASTYS LLSLMNAASS MGGSSAAAID ELSSLVGHGP PAYFNHQAGG  360
VHSHSFLPLP TPSSQPMAVG TLPMSLAAIS DKIWEWNPIP DAAARDYSIA GFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-534519019165NO APICAL MERISTEM PROTEIN
1ut4_B1e-534519019165NO APICAL MERISTEM PROTEIN
1ut7_A1e-534519019165NO APICAL MERISTEM PROTEIN
1ut7_B1e-534519019165NO APICAL MERISTEM PROTEIN
4dul_A1e-534519019165NAC domain-containing protein 19
4dul_B1e-534519019165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9571310.0EU957131.1 Zea mays clone 1583712 hypothetical protein mRNA, complete cds.
GenBankBT0398640.0BT039864.1 Zea mays full-length cDNA clone ZM_BFc0047I12 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970843.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 1
TrEMBLK3XIC90.0K3XIC9_SETIT; Uncharacterized protein
STRINGSi001651m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28263787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.21e-102NAC domain containing protein 35