PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do014819.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family WOX
Protein Properties Length: 137aa    MW: 15119.3 Da    PI: 4.8616
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do014819.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.88.8e-19663254
                T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHH CS
    Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRak 54
                ++R+++t+eql +Lee++ +  r+p+a+e+++++++l    +++ ++V++WFqN++  
  Do014819.1  6 STRWCPTPEQLMILEEMYXSgVRTPNAAEIQQITAHLayygRIEGKNVFYWFQNHKLS 63
                58*****************99**********************************975 PP

2Wus_type_Homeobox108.73.3e-35564261
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRe 61
                       ++tRW+PtpeQ++iLee+y sG+rtPn++eiq+ita+L+ yG+ie+kNVfyWFQN+k  +
         Do014819.1  5 PSTRWCPTPEQLMILEEMYXSGVRTPNAAEIQQITAHLAYYGRIEGKNVFYWFQNHKLSN 64
                       689*****************************************************9655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500718.665267IPR001356Homeobox domain
SMARTSM003890.0078471IPR001356Homeobox domain
CDDcd000861.45E-4560No hitNo description
PfamPF000461.7E-16663IPR001356Homeobox domain
SuperFamilySSF466893.42E-10764IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-5861IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
MPQTPSTRWC PTPEQLMILE EMYXSGVRTP NAAEIQQITA HLAYYGRIEG KNVFYWFQNH  60
KLSNQQLEEW DAAETMEHCN ANCGAASGSS DEGGAALQLP PCCRRPLXTL DLFPTKSTGL  120
KDECSSSKSS SCSTSTN
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor required to initiate organ founder cells in a lateral domain of shoot meristems. Involved in leaf formation. {ECO:0000269|PubMed:15169755}.
UniProtProbable transcription factor required to initiate organ founder cells in a lateral domain of shoot meristems. Involved in leaf formation. {ECO:0000269|PubMed:15169755}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo014819.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ5365782e-79AJ536578.1 Zea mays mRNA for homeodomain transcription factor (prs gene).
GenBankBT0661202e-79BT066120.1 Zea mays full-length cDNA clone ZM_BFb0350F05 mRNA, complete cds.
GenBankJX4699422e-79JX469942.1 Zea mays subsp. mays clone UT3202 HB-type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015692532.18e-49PREDICTED: WUSCHEL-related homeobox 3-like
SwissprotQ6S3I33e-39WOX3B_MAIZE; WUSCHEL-related homeobox 3B
SwissprotQ70UV13e-39WOX3A_MAIZE; WUSCHEL-related homeobox 3A
TrEMBLM0TXB83e-43M0TXB8_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr9P04090_0016e-44(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21773897
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.11e-35WOX family protein
Publications ? help Back to Top
  1. Scanlon MJ
    NARROW SHEATH1 functions from two meristematic foci during founder-cell recruitment in maize leaf development.
    Development, 2000. 127(21): p. 4573-85
    [PMID:11023861]