PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do014741.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family HD-ZIP
Protein Properties Length: 780aa    MW: 84445.4 Da    PI: 5.5466
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do014741.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.31.7e-20103159157
                 TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
    Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                 +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k+
  Do014741.1 103 KKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKN 159
                 688999************************************************995 PP

2START208.13.5e-652965171206
                 HHHHHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEE CS
       START   1 elaeeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevi 85 
                 ela +a++elv++a+++ep+W         e +n++e+ ++f+++ +      ++ea+r+s vv+m++a+lve+l+d++ q+ + +     +a+tlev+
  Do014741.1 296 ELAVAAMEELVRMAQLDEPLWNAPGldgpsETLNEEEYARIFPRGLGpkqygLKSEASRDSSVVIMTHANLVEILMDVN-QYATVFSsivsRAATLEVL 393
                 57899****************988789999************998889*******************************.88888888888******** PP

                 CTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXX CS
       START  86 ssg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlp 177
                 s+g      galq+m+ e+q++splvp R+++fvRy++q  +g+w++vdvS+ds ++ +    v +++++pSg+li++++ng+skvtwvehv++++r++
  Do014741.1 394 STGvagnynGALQVMSVEFQVPSPLVPtRESYFVRYCKQNADGTWAVVDVSLDSLRPGS----VLKCRRRPSGCLIQEMPNGYSKVTWVEHVEVDDRSV 488
                 *********************************************************97....8*********************************** PP

                 HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
       START 178 hwllrslvksglaegaktwvatlqrqcek 206
                 h++++ lv+sgla+ga++wv tl+rqce+
  Do014741.1 489 HNIYKLLVNSGLAFGARRWVGTLDRQCER 517
                 ***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.94E-2088160IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.4E-2388144IPR009057Homeodomain-like
PROSITE profilePS5007117.022100160IPR001356Homeobox domain
SMARTSM003891.1E-19101164IPR001356Homeobox domain
CDDcd000861.46E-19103161No hitNo description
PfamPF000464.2E-18103158IPR001356Homeobox domain
PROSITE patternPS000270135158IPR017970Homeobox, conserved site
Gene3DG3DSA:1.10.10.607.9E-4145187IPR009057Homeodomain-like
PROSITE profilePS5084841.682287520IPR002913START domain
SuperFamilySSF559617.33E-36288519No hitNo description
CDDcd088751.95E-123291516No hitNo description
SMARTSM002342.9E-61296517IPR002913START domain
PfamPF018522.9E-54297517IPR002913START domain
Gene3DG3DSA:3.30.530.209.9E-6358513IPR023393START-like domain
SuperFamilySSF559614.95E-24538769No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009913Biological Processepidermal cell differentiation
GO:0048497Biological Processmaintenance of floral organ identity
GO:0048825Biological Processcotyledon development
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 780 aa     Download sequence    Send to blast
MMIPARHMPS MIGRNGAAAY GSSSALSLGQ PNLLDNPQLQ QALHQQHLLD QIPATTAESG  60
DNMMRGGRGS DPLGDEFESK SGSENVDGVS VDDQDPNQRP NKKKRYHRHT QHQIQEMEAF  120
FKECPHPDDK QRKELSRELG LEPLQVKFWF QNKRTQMKNQ HERQENSQLR AENEKLRAEN  180
MRYKEALSSA SCPNCGGPAA LGEMSFDEHH LRIENARLRD EIDRISAIAA KYVGKPMVSF  240
PVLSSPLAAA RASTLDIGVG AVAYGTADIF GGVTAGAGEL LRGAVQSDAD KPMIVELAVA  300
AMEELVRMAQ LDEPLWNAPG LDGPSETLNE EEYARIFPRG LGPKQYGLKS EASRDSSVVI  360
MTHANLVEIL MDVNQYATVF SSIVSRAATL EVLSTGVAGN YNGALQVMSV EFQVPSPLVP  420
TRESYFVRYC KQNADGTWAV VDVSLDSLRP GSVLKCRRRP SGCLIQEMPN GYSKVTWVEH  480
VEVDDRSVHN IYKLLVNSGL AFGARRWVGT LDRQCERLAS VMASNIPTSD IGVITSAEGR  540
KSMLKLAERM VMSFCGGVTA SAAHQWTTLS GSGAEDVRVM TRKSVDDPGR PPGIVLNAAT  600
SFWLPVPPKR VFDFLRDESS RSEWDILSNG GIVQEMAHIA NGRDHGNCVS LLRVNSTNSN  660
QSNMLILQES CTDASGSYVI YAPVDVVAMN VVLNGGDPDY VALLPSGFAI LPDGPAGADM  720
QGEGSMGSSG SLLTVAFQIL VDSVPTAKLS LGSVATVNSL IACTVERIKA AVSSGESNPQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo014741.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976894.10.0homeobox-leucine zipper protein ROC2
SwissprotQ0J9X20.0ROC2_ORYSJ; Homeobox-leucine zipper protein ROC2
TrEMBLA0A1E5WHW10.0A0A1E5WHW1_9POAL; Homeobox-leucine zipper protein ROC2
STRINGSi009409m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2
Publications ? help Back to Top
  1. Chou IT,Gasser CS
    Characterization of the cyclophilin gene family of Arabidopsis thaliana and phylogenetic analysis of known cyclophilin proteins.
    Plant Mol. Biol., 1997. 35(6): p. 873-92
    [PMID:9426607]