PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do014725.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family WOX
Protein Properties Length: 265aa    MW: 28814.4 Da    PI: 7.694
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do014725.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox48.81.2e-152080257
                T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                r+R+++++eq+ +Le+ F++   +p ++e +++ + l     + +++V++WFqNrR + ++
  Do014725.1 20 RSRWAPKPEQILILESIFNSgMVNPAKDETARIRRLLerfgAVRDANVFYWFQNRRSRSRR 80
                89*****************99*************************************997 PP

2Wus_type_Homeobox104.95.3e-341981264
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       ar+RW+P+peQi iLe++++sG+++P+k+e+ ri++ Le++G+++d+NVfyWFQNr++R+r++
         Do014725.1 19 ARSRWAPKPEQILILESIFNSGMVNPAKDETARIRRLLERFGAVRDANVFYWFQNRRSRSRRR 81
                       689**********************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.68E-131587IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.9E-91686IPR009057Homeodomain-like
PROSITE profilePS5007111.4341681IPR001356Homeobox domain
SMARTSM003892.2E-51885IPR001356Homeobox domain
PfamPF000462.2E-132080IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009734Biological Processauxin-activated signaling pathway
GO:0048830Biological Processadventitious root development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MDSQHGQAHR SGGGEPTAAR SRWAPKPEQI LILESIFNSG MVNPAKDETA RIRRLLERFG  60
AVRDANVFYW FQNRRSRSRR RARQLQQACG AAAQLPTTGV VGTGHYHGFN DNASPFLMNG  120
HSQVRSSMMP TAAPLPSMAE TAPHFFADEV DSGDDLFAIS RQMGLMSRGG DHRCGYTAND  180
ASQLSYQPTG TASIQVFING AVYEVPGAGT PLDLAGTFGR DAMLVHSSGE ILPVNEHGVL  240
MKSLQMGECY YLVGFEINLI SRPAV
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00330DAPTransfer from AT3G03660Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo014725.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0052491e-106AP005249.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OSJNBa0087F21.
GenBankAP0149641e-106AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankCP0126161e-106CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022683622.11e-159WUSCHEL-related homeobox 10
SwissprotA2YST11e-100WOX10_ORYSI; WUSCHEL-related homeobox 10
TrEMBLA0A1E5VIR50.0A0A1E5VIR5_9POAL; WUSCHEL-related homeobox 10
STRINGSi015065m1e-158(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP107837109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17810.23e-28WUSCHEL related homeobox 12