PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do014406.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family TCP
Protein Properties Length: 330aa    MW: 33753.8 Da    PI: 4.7962
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do014406.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP103.34e-32701617102
         TCP   7 rhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaaksaakskksqk 102
                 r  ++hTkv+gR+RR+R+ a+caar+  L++ LG+++d++t+ WLlqq++pai+++tgt++ +a +++ ++ +     +     a++ a+++++q 
  Do014406.1  70 RYRDRHTKVEGRGRRIRMAAPCAARVARLTRDLGHKSDGETVRWLLQQSEPAIIAATGTGTVPAIAVTGSDGVLRLPPE----PAPAGAEQQEQQP 161
                 678********************************************************99998666444444444411....1111111111111 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136923.47171125IPR017887Transcription factor TCP subgroup
PfamPF036346.9E-2572134IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MESRAPGMGE EHAEALYLAA EAVGNGAAAA VTVAVDAMGS IEAGLPKPEP VPVEFLGGGL  60
QLAHPRPAPR YRDRHTKVEG RGRRIRMAAP CAARVARLTR DLGHKSDGET VRWLLQQSEP  120
AIIAATGTGT VPAIAVTGSD GVLRLPPEPA PAGAEQQEQQ PAPKRRRKLQ PTRAAAGPSA  180
LAPTPPPAAY YPVVADPLLQ ANGGGAISMS SGIAPASGPA AAPAGAIPFL AIPAPAPGAA  240
GDGKQMIPPA AVWMVPQQAG AAGAPNQPTH YWAFPTNPEL FSAANFQQQA VYDAEQLAGN  300
GESQDQQPAG YQLGEGDDEE IAVTDSSSEE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1162168PKRRRKL
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681}.
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681, ECO:0000269|PubMed:9338963}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo014406.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025803340.11e-172transcription factor PCF2-like
SwissprotA2YXQ16e-77PCF2_ORYSI; Transcription factor PCF2
SwissprotQ6ZBH66e-77PCF2_ORYSJ; Transcription factor PCF2
TrEMBLA0A1E5V3G20.0A0A1E5V3G2_9POAL; Transcription factor PCF2
STRINGPavir.Ba01284.1.p1e-154(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39123167
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51910.21e-33TCP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]