PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do013843.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family HD-ZIP
Protein Properties Length: 274aa    MW: 29560.9 Da    PI: 4.9104
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do013843.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.11.4e-1852105356
                 --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 k++++++eq+++Le  Fe ++++  e++++LA+ lgL+ rqV vWFqNrRa++k
  Do013843.1  52 KKRRLSAEQVRALEWSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWK 105
                 45689************************************************9 PP

2HD-ZIP_I/II132.91.1e-4252143293
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  kkrrls+eqv++LE sFe e+kLeperK++lar+LglqprqvavWFqnrRAR+ktkqlE+dy+aL+++ydal++++++L++++++L +e+k+
   Do013843.1  52 KKRRLSAEQVRALEWSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLERDYAALRHSYDALRHDHDALRRDKDALLAEIKK 143
                  9**************************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.13E-1950109IPR009057Homeodomain-like
SMARTSM003892.8E-1650111IPR001356Homeobox domain
PROSITE profilePS5007116.50352107IPR001356Homeobox domain
CDDcd000861.05E-1652108No hitNo description
PfamPF000467.0E-1652105IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.5E-1954114IPR009057Homeodomain-like
PRINTSPR000319.3E-67887IPR000047Helix-turn-helix motif
PROSITE patternPS00027082105IPR017970Homeobox, conserved site
PRINTSPR000319.3E-687103IPR000047Helix-turn-helix motif
PfamPF021832.3E-17107148IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009637Biological Processresponse to blue light
GO:0030308Biological Processnegative regulation of cell growth
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048573Biological Processphotoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MKRPRSGSPS LLPMANPDGK LTASFSYDGY GVAGMVAEGD AEEEEMVACG GKKRRLSAEQ  60
VRALEWSFEV ENKLEPERKA RLARDLGLQP RQVAVWFQNR RARWKTKQLE RDYAALRHSY  120
DALRHDHDAL RRDKDALLAE IKKLKAKLGD EEAAASFTSV KAEPTASDGP PAAGVGSSES  180
DSSAVLNDAD HAPVAEAPAP EVVQGPLLPP TPAAAACAGA AAAGHGGAFF HGSFLKVEED  240
ETGFLNDEEP CGGFFAVEQP PPMAWWTEPT EHWS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17682ERKARLA
299107RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription activator that binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. May be involved in the regulation of gibberellin signaling. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:18049796}.
UniProtProbable transcription activator that binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. May be involved in the regulation of gibberellin signaling. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:18049796}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00051PBMTransfer from AT4G40060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo013843.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By gibberellin. Down-regulated in leaves by drought stress. {ECO:0000269|PubMed:17999151, ECO:0000269|PubMed:18049796}.
UniProtINDUCTION: By gibberellin. Down-regulated in leaves by drought stress. {ECO:0000269|PubMed:17999151, ECO:0000269|PubMed:18049796}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0368560.0BT036856.2 Zea mays full-length cDNA clone ZM_BFb0143M01 mRNA, complete cds.
GenBankBT0545000.0BT054500.1 Zea mays full-length cDNA clone ZM_BFc0103D23 mRNA, complete cds.
GenBankJX5148320.0JX514832.1 Zea mays cultivar B73 homeodomain leucine zipper protein 10 (hdz10) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957072.11e-152homeobox-leucine zipper protein HOX4
SwissprotQ6K4981e-118HOX4_ORYSJ; Homeobox-leucine zipper protein HOX4
SwissprotQ9XH371e-118HOX4_ORYSI; Homeobox-leucine zipper protein HOX4
TrEMBLA0A1E5VJA80.0A0A1E5VJA8_9POAL; Homeobox-leucine zipper protein HOX4
STRINGSi030822m1e-151(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30093482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.15e-49homeobox protein 16
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]