PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do013733.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family bZIP
Protein Properties Length: 193aa    MW: 21189 Da    PI: 7.5336
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do013733.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.59.3e-113987250
                XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1  2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50
                +el++ r+   NReA r++R++Kka  + Lee+vk+L a N++L  +l+
  Do013733.1 39 EELRKLRKPLGNREAVRKYREKKKAHAAFLEEEVKKLRATNQQLLRRLQ 87
                689999**************************************98887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.0E-1534106No hitNo description
SMARTSM003383.6E-1138105IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.9794087IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.81E-84188No hitNo description
PfamPF077164.7E-124295IPR004827Basic-leucine zipper domain
CDDcd146862.10E-94396No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
LKSTTACTHT HTCNPPGPSA AMHTHTCLHT HTQVVASGEE LRKLRKPLGN REAVRKYREK  60
KKAHAAFLEE EVKKLRATNQ QLLRRLQGHA ALEAEVVRLR CLLFDVRGKI DAEVDSFPFQ  120
KHNSVGSLTC TDTPPCFNTN AEVTAREASS GGITILDFEI DESGCISREL DIREVVNSMD  180
AAASLVNSAS LAE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970277.11e-108PREDICTED: uncharacterized protein LOC101760983
RefseqXP_004970278.11e-108PREDICTED: uncharacterized protein LOC101760983
SwissprotQ8GTS29e-52BZP23_ARATH; Basic leucine zipper 23
TrEMBLK3XLX01e-108K3XLX0_SETIT; Uncharacterized protein
STRINGSi002893m1e-107(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38313675
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.11e-52bZIP family protein