PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do013671.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family NAC
Protein Properties Length: 344aa    MW: 38776.1 Da    PI: 6.9628
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do013671.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.51.1e-52101391128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                 +ppGfrFhPtdeel+ +yL+kkv+ ++++l +vi+e+d++k+ePwdL+   ++ +  ++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk+++ ++
  Do013671.1  10 VPPGFRFHPTDEELLYYYLRKKVAYEPIDL-DVIREIDLNKLEPWDLKDrcRIGTgPQNEWYFFSHKDKKYPTGTRTNRATTAGFWKATGRDKAIFLSN 107
                 69****************************.9***************943444442456**************************************** PP

         NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  + +gl+ktLvfy grap+g+ktdW+mheyrl
  Do013671.1 108 ARRIGLRKTLVFYIGRAPHGKKTDWIMHEYRL 139
                 ******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.75E-596159IPR003441NAC domain
PROSITE profilePS5100558.10810159IPR003441NAC domain
PfamPF023651.5E-2711139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003002Biological Processregionalization
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0010455Biological Processpositive regulation of cell fate commitment
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MHPSGGPLSV PPGFRFHPTD EELLYYYLRK KVAYEPIDLD VIREIDLNKL EPWDLKDRCR  60
IGTGPQNEWY FFSHKDKKYP TGTRTNRATT AGFWKATGRD KAIFLSNARR IGLRKTLVFY  120
IGRAPHGKKT DWIMHEYRLD EENVEIQEDG WVVCRVFKKK NYQRGFNPAE MAALDDDELQ  180
PFQVPVPGAL PTDHKHNPHL MQYEFPSFDP SMQLPQLMNA DQPVQTLLPS QPGVAMAMSS  240
LDVECSQNLM KLTSNGSDGM IHGGGGGGGV DRFTGTTDWS ILDKLLASHQ NLDQLFQGKV  300
STASAAPMAP YHHQLMELGG SSSLQRLPLQ YLGSEAADLL RFPK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-52816115167NO APICAL MERISTEM PROTEIN
1ut4_B5e-52816115167NO APICAL MERISTEM PROTEIN
1ut7_A5e-52816115167NO APICAL MERISTEM PROTEIN
1ut7_B5e-52816115167NO APICAL MERISTEM PROTEIN
4dul_A5e-52816115167NAC domain-containing protein 19
4dul_B5e-52816115167NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00250DAPTransfer from AT1G79580Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ8339650.0AJ833965.1 Zea mays partial mRNA for hypothetical protein (nac6 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965525.10.0PREDICTED: NAC domain-containing protein 76
SwissprotQ5Z6B61e-122NAC76_ORYSJ; NAC domain-containing protein 76
TrEMBLK3Y0W10.0K3Y0W1_SETIT; Uncharacterized protein
STRINGSi007822m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34613781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79580.31e-102NAC family protein