PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do013308.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family HD-ZIP
Protein Properties Length: 237aa    MW: 26208 Da    PI: 4.7106
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do013308.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.51.2e-193084256
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                +++ +f++eq++ Le++F+ + ++  +++ +LA++lgL+ rqV +WFqN+Ra++k
  Do013308.1 30 KNKKRFSEEQIKSLESMFATQTKLEPRQKLQLARELGLQPRQVAIWFQNKRARWK 84
                67789*************************************************9 PP

2HD-ZIP_I/II122.61.9e-3931122293
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  +k+r+s+eq+k+LE++F +++kLep++K +lareLglqprqva+WFqn+RAR+k+kqlE++y+aL++ ydal+ + e+L+ke+++L ++l++
   Do013308.1  31 NKKRFSEEQIKSLESMFATQTKLEPRQKLQLARELGLQPRQVAIWFQNKRARWKSKQLEREYSALRDDYDALVCSYESLKKEKHALLKQLEK 122
                  79*************************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.99E-192388IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.1E-202386IPR009057Homeodomain-like
PROSITE profilePS5007117.3622686IPR001356Homeobox domain
SMARTSM003891.9E-162990IPR001356Homeobox domain
PfamPF000465.0E-173084IPR001356Homeobox domain
CDDcd000863.41E-173087No hitNo description
PRINTSPR000317.7E-65766IPR000047Helix-turn-helix motif
PROSITE patternPS0002706184IPR017970Homeobox, conserved site
PRINTSPR000317.7E-66682IPR000047Helix-turn-helix motif
PfamPF021831.5E-1286128IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MEGEDDGPEW MMEVGGGGEK GKGGGGALDK NKKRFSEEQI KSLESMFATQ TKLEPRQKLQ  60
LARELGLQPR QVAIWFQNKR ARWKSKQLER EYSALRDDYD ALVCSYESLK KEKHALLKQL  120
EKLADMLQEP REKYGGNADA VAGEDVPSGV GGMKEEFADA GAGLYSSEGA DGGKFAHFTD  180
DDAGGLFRPS PQQPAAGFTT SGPPEHQPFQ FHSSCWPSST EQTCSSSQWW EFESLSE
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. {ECO:0000269|PubMed:10732669}.
UniProtProbable transcription factor that binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. {ECO:0000269|PubMed:10732669}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00650PBMTransfer from LOC_Os09g35910Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo013308.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0872580.0BT087258.1 Zea mays full-length cDNA clone ZM_BFb0020F23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957433.11e-155homeobox-leucine zipper protein HOX6
SwissprotQ651Z52e-94HOX6_ORYSJ; Homeobox-leucine zipper protein HOX6
SwissprotQ9XH352e-94HOX6_ORYSI; Homeobox-leucine zipper protein HOX6
TrEMBLA0A1E5V4471e-172A0A1E5V447_9POAL; Homeobox-leucine zipper protein HOX6
STRINGSi030983m1e-155(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78733448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.12e-43homeobox 7
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]