PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do013221.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family HD-ZIP
Protein Properties Length: 700aa    MW: 76565.8 Da    PI: 6.3298
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do013221.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.47.9e-211671156
                TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                r++ +++t+ q+++Le++F+++++p++++r+ L+++lgL+ rq+k+WFqNrR+++k
  Do013221.1 16 RKRYHRHTPRQIQQLEAMFKECPHPDENQRAALSRELGLEPRQIKFWFQNRRTQMK 71
                789999***********************************************998 PP

2START153.61.6e-482154392206
                 HHHHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS............SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEE CS
       START   2 laeeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv...........dsgealrasgvvdmvlallveellddkeqWdetla....kae 80 
                 +a +a++el+++a+a+e++Wvk++     e +n + + +      +            ++e +r+sg+v+m ++ lv  ++d++ +W e ++    ka 
  Do013221.1 215 MATRAMDELIRLAQAGEQVWVKDVhgderETLNVTNYDSL-----FakpggafrppdINVEGSRDSGLVFMSAVGLVDVFMDTN-KWMEFFPgivsKAH 307
                 57899*******************7655533333333333.....23445589***99**************************.************** PP

                 EEEEECTT.....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE-- CS
       START  81 tlevissg.....galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlk 173
                 t++v+ +g     + l  m+ el  ++p+vp R+f f+Ry++q ++g w+++dvS+d +++        R+++lpSg+li ++sng+skvtwveh++ +
  Do013221.1 308 TVDVLVNGlggrsESLIMMYEELHIMTPIVPtREFSFLRYCKQIEQGLWAVADVSLDGQRDAH-CGMPSRSRRLPSGCLIADMSNGYSKVTWVEHMEIE 405
                 *************************************************************98.46667999*************************** PP

                 SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
       START 174 grlp.hwllrslvksglaegaktwvatlqrqcek 206
                   lp   l+r lv sg+a+ga +w+a+lqr ce+
  Do013221.1 406 QTLPiNLLFRNLVLSGAAFGAHRWLAALQRACER 439
                 ****99**************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.97E-20976IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-221078IPR009057Homeodomain-like
PROSITE profilePS5007117.7831373IPR001356Homeobox domain
SMARTSM003894.5E-191477IPR001356Homeobox domain
PfamPF000462.5E-181671IPR001356Homeobox domain
CDDcd000863.04E-191674No hitNo description
PROSITE patternPS0002704871IPR017970Homeobox, conserved site
PROSITE profilePS5084846.215205442IPR002913START domain
SuperFamilySSF559612.47E-31207441No hitNo description
CDDcd088751.30E-105209438No hitNo description
SMARTSM002341.2E-35214439IPR002913START domain
PfamPF018526.0E-41215439IPR002913START domain
SuperFamilySSF559618.33E-18457692No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009828Biological Processplant-type cell wall loosening
GO:0010091Biological Processtrichome branching
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 700 aa     Download sequence    Send to blast
MDFGDEPEGS DSQRQRKRYH RHTPRQIQQL EAMFKECPHP DENQRAALSR ELGLEPRQIK  60
FWFQNRRTQM KAQHERADNC FLRAENDKIR CENITMREAL RNVICPTCGG PPVADDYFDE  120
QKLRMENARL KEELDRLSSV TSKYLGRPFT QMPPVPPMSV SSLDLSVGGM PGQGLGGGPS  180
LDLDLLSGGS SGYHHPSFHL PTAVSELERP MMAEMATRAM DELIRLAQAG EQVWVKDVHG  240
DERETLNVTN YDSLFAKPGG AFRPPDINVE GSRDSGLVFM SAVGLVDVFM DTNKWMEFFP  300
GIVSKAHTVD VLVNGLGGRS ESLIMMYEEL HIMTPIVPTR EFSFLRYCKQ IEQGLWAVAD  360
VSLDGQRDAH CGMPSRSRRL PSGCLIADMS NGYSKVTWVE HMEIEQTLPI NLLFRNLVLS  420
GAAFGAHRWL AALQRACERF ASLAVLGAPL HDLGGVTPEG KRSMMKLSXR MVSSFCASLS  480
SSPLQRWTLL LGTTDVSIRV STHRSADPGQ PNSVVLSAAI SIWLPVPGDH VFAFVRDENA  540
RSQWDVLSHG NQVQEVSRVP YGSNHGNCIS LLRGLNANQN NMLILQDSCT DASGSLVVYS  600
PIDIPAANVV MSGEDPSAIP LLPSGFAIFP DGQPSSGGAG PSRSASTLAP PPGCVVTIAF  660
QILVSNLPSS RLNAESVATV NSLIGTTVQQ IRAALNCAGA
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00232DAPTransfer from AT1G73360Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo013221.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0668130.0BT066813.2 Zea mays full-length cDNA clone ZM_BFb0073D09 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002438026.10.0homeobox-leucine zipper protein ROC8
SwissprotQ69T580.0ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8
TrEMBLA0A1E5WJ530.0A0A1E5WJ53_9POAL; Homeobox-leucine zipper protein ROC8
STRINGSb10g006820.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29123770
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11