PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do013120.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family NAC
Protein Properties Length: 419aa    MW: 44055.3 Da    PI: 8.6936
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do013120.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.21.5e-53311591128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk..kg 97 
                 lppGfrFhPtdeelvv+yLkkk+++ +l++  +i+e+d+yk++Pw+Lp k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk++l++  ++
  Do013120.1  31 LPPGFRFHPTDEELVVHYLKKKAASAPLPV-AIIAEIDLYKFDPWELPDKASFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPILASggNR 128
                 79****************************.88***************888899****************************************98888 PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 e+vg+kk Lvfy+g+ pkg kt+W+mheyrl
  Do013120.1 129 EKVGVKKALVFYRGKPPKGLKTNWIMHEYRL 159
                 88***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.28E-6328201IPR003441NAC domain
PROSITE profilePS5100561.65531201IPR003441NAC domain
PfamPF023655.9E-2832159IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009753Biological Processresponse to jasmonic acid
GO:0045995Biological Processregulation of embryonic development
GO:0048317Biological Processseed morphogenesis
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MRSMESTDSS SGSAPPQQRQ QQKQPGSAPD LPPGFRFHPT DEELVVHYLK KKAASAPLPV  60
AIIAEIDLYK FDPWELPDKA SFGEQEWYFF SPRDRKYPNG ARPNRAATSG YWKATGTDKP  120
ILASGGNREK VGVKKALVFY RGKPPKGLKT NWIMHEYRLA DAASSTTNRP PPPPPPPATA  180
GGGKATSLRL DDWVLCRIYK KANKLGVGDQ QRSVECEDSD EDAVVAAYPR HAAAAMAAAA  240
GGGAAHGGNY TSLLGHQDSF LDGLLTVTAE DAGGLSAGAS SLSHLAAAAR AAPAATKQLL  300
VPSSTPFNWL DASALAILPP TKRSYHGYSR DTTTTDGGMS LSSPSERNNL GPVGAGAIEN  360
GTSGGGGGAT AIPTFLNPLG VQAAATYHHH AILGTPVSPE AAACTFQHPY QLPGVNWNP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D5e-732120110168NAC domain-containing protein 19
3swp_C5e-732120110168NAC domain-containing protein 19
3swp_B5e-732120110168NAC domain-containing protein 19
3swp_A5e-732120110168NAC domain-containing protein 19
3swm_D5e-732120110168NAC domain-containing protein 19
3swm_C5e-732120110168NAC domain-containing protein 19
3swm_B5e-732120110168NAC domain-containing protein 19
3swm_A5e-732120110168NAC domain-containing protein 19
4dul_B5e-73212017165NAC domain-containing protein 19
4dul_A5e-73212017165NAC domain-containing protein 19
1ut7_B5e-73212017165NO APICAL MERISTEM PROTEIN
1ut7_A5e-73212017165NO APICAL MERISTEM PROTEIN
1ut4_B5e-73212017165NO APICAL MERISTEM PROTEIN
1ut4_A5e-73212017165NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00361DAPTransfer from AT3G15510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0864670.0BT086467.1 Zea mays full-length cDNA clone ZM_BFc0169O24 mRNA, complete cds.
GenBankBT0859890.0BT085989.1 Zea mays full-length cDNA clone ZM_BFc0095M07 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958056.10.0PREDICTED: NAC transcription factor NAM-B2
SwissprotA0SPJ90.0NAM2_HORVD; NAC transcription factor NAM-2
TrEMBLK4A1D30.0K4A1D3_SETIT; Uncharacterized protein
STRINGSi032676m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75723649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-89NAC domain containing protein 2