PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do012864.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family LBD
Protein Properties Length: 189aa    MW: 20543.8 Da    PI: 6.5001
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do012864.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26041.44e-133869132
      DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfan 32
                +CaaCk+lrr+Ca+dCvlapyfpa+qp+++a+
  Do012864.1 38 RCAACKYLRRRCAPDCVLAPYFPASQPRRYAY 69
                6***************************9986 PP

2DUF26042.61.8e-137012348101
      DUF260  48 alpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101
                 +lp +er +a+++++ eA++r++dPvyG++gvi +lqq+++ +++ela+++++l
  Do012864.1  70 SLPVQERGRAADTMATEARWRMQDPVYGCTGVIYRLQQEIRAVQHELARTRAQL 123
                 578899*******************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089111.79937123IPR004883Lateral organ boundaries, LOB
PfamPF031955.6E-113868IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-1171120IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MSSSSSSAGA GSMEVDHQQL LDYGGGGCGG GNNNNPRRCA ACKYLRRRCA PDCVLAPYFP  60
ASQPRRYAYS LPVQERGRAA DTMATEARWR MQDPVYGCTG VIYRLQQEIR AVQHELARTR  120
AQLAVHVQGT ALLQRTQQPT PLLPPPXPLA PAAAVAVHAG AHGVTVHEEE DEEAPLMDPD  180
EFLDLDGRF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-203912312111LOB family transfactor Ramosa2.1
5ly0_B6e-203912312111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo012864.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022683529.12e-61LOB domain-containing protein 24
TrEMBLA0A1E5VMB81e-136A0A1E5VMB8_9POAL; LOB domain-containing protein 24
STRINGSi015521m2e-67(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52823562
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.15e-30LOB domain-containing protein 24