PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do012693.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GRAS
Protein Properties Length: 444aa    MW: 48831.7 Da    PI: 6.3453
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do012693.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS162.34e-502754402168
        GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                 ++lL++cA+a + +d+++ ++lL+++++++s +gd+ qRla+yf+++L+arla+++s++y++l++++ts   + + l+a++l+++++P+  +s+ +aN+
  Do012693.1 275 TTLLIHCAQAAAIDDHRNSNELLKQIRKHSSATGDACQRLAHYFANGLEARLAGTGSSIYRSLAAKRTS---TGDILKAFHLYVKACPFSLISYYVANS 370
                 689************************************************************999999...899************************ PP

        GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakf 168
                 +Il+a ++++++HiiD++i++G+Q+p L+q L++R +gppslRiTg++ p++g   +e++e+tg+rL+++
  Do012693.1 371 TILNASKSATKLHIIDYGIKYGFQYPVLMQRLSNRHGGPPSLRITGIDFPQPGfrPAERIEATGRRLHEL 440
                 ****************************************************9**************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098535.783248444IPR005202Transcription factor GRAS
PfamPF035141.4E-47275440IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 444 aa     Download sequence    Send to blast
MAMDPGSRND IDFGDVFSTS NPPTGHMINF SLQQQSQVQF FPSYGLHSHN PPVSSHPSPS  60
QVMLGCTTPS PASTTTTELD NSEEIHETVT DDTVLAYINQ FLLEDEDDEY FPVTSVPVEG  120
SALLAVEKPF VDILKSTKPA QAYEGKSWTT GHCDSTEMGG LDDVVRSTQK SCQLPCETVK  180
EDSVCAAHKG RKNPYEDGLE MEERKSKQSA LCEEETVREM FDKVLLCTDE KCVFRSPLPI  240
DAQISSGYVK GSGNRRGRRK GRSGGGPEEE TVDLTTLLIH CAQAAAIDDH RNSNELLKQI  300
RKHSSATGDA CQRLAHYFAN GLEARLAGTG SSIYRSLAAK RTSTGDILKA FHLYVKACPF  360
SLISYYVANS TILNASKSAT KLHIIDYGIK YGFQYPVLMQ RLSNRHGGPP SLRITGIDFP  420
QPGFRPAERI EATGRRLHEL KNST
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-242784408170GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981240.10.0PREDICTED: scarecrow-like protein 30
TrEMBLA0A0A9TYC80.0A0A0A9TYC8_ARUDO; Uncharacterized protein
STRINGSi034627m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP138412529
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.16e-70SCARECROW-like 14