PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do012456.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family HD-ZIP
Protein Properties Length: 196aa    MW: 22054.2 Da    PI: 9.1944
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do012456.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.81e-1946100256
                 T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 rk+ +++k+q  +Le+ F+++++++ ++++ LA++lgL  rqV vWFqNrRa+ k
  Do012456.1  46 RKKLRLSKDQSAVLEDSFREHPTLNPRQKAALAQQLGLRPRQVEVWFQNRRARTK 100
                 788899***********************************************98 PP

2HD-ZIP_I/II129.91e-4146135191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rlsk+q+++LE+sF+e+ +L+p++K++la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr +l
   Do012456.1  46 RKKLRLSKDQSAVLEDSFREHPTLNPRQKAALAQQLGLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCETLTEENRRLQKEVQELR-AL 135
                  69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.6E-1937103IPR009057Homeodomain-like
PROSITE profilePS5007117.31342102IPR001356Homeobox domain
SMARTSM003897.4E-1844106IPR001356Homeobox domain
PfamPF000464.7E-1746100IPR001356Homeobox domain
CDDcd000862.07E-1546103No hitNo description
Gene3DG3DSA:1.10.10.605.3E-1946100IPR009057Homeodomain-like
PRINTSPR000313.1E-67382IPR000047Helix-turn-helix motif
PROSITE patternPS00027077100IPR017970Homeobox, conserved site
PRINTSPR000313.1E-68298IPR000047Helix-turn-helix motif
PfamPF021831.6E-11102136IPR003106Leucine zipper, homeobox-associated
SMARTSM003404.4E-25102145IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MLLRSPEKRF LEMPLLPAKR SEVAAEEGLR GGSDEEDGGC GIDGSRKKLR LSKDQSAVLE  60
DSFREHPTLN PRQKAALAQQ LGLRPRQVEV WFQNRRARTK LKQTEVDCEF LKRCCETLTE  120
ENRRLQKEVQ ELRALKLVSP HLYMHMSPPT TLTMCPSCER VSSSNTSSTA ASSDRRVAAD  180
AAAVCHRPIA VRPQQS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14450SRKKLRL
294102RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo012456.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9749800.0EU974980.1 Zea mays clone 462177 homeobox-leucine zipper protein ATHB-4 mRNA, complete cds.
GenBankKJ7283620.0KJ728362.1 Zea mays clone pUT6644 HB transcription factor (HB53) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976428.11e-125homeobox-leucine zipper protein HOX17
SwissprotQ01I231e-104HOX17_ORYSI; Homeobox-leucine zipper protein HOX17
TrEMBLA0A1E5VNI81e-140A0A1E5VNI8_9POAL; Homeobox-leucine zipper protein HOX17
STRINGSi010958m1e-125(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25873889
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60390.14e-74homeobox-leucine zipper protein 3