PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do012440.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family WOX
Protein Properties Length: 340aa    MW: 36546.1 Da    PI: 9.7069
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do012440.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.53.5e-214099357
                --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                 R+++tkeql +Le+l+e   r+psae++++++++l    +++ ++V++WFqN++a++++
  Do012440.1 40 ARWNPTKEQLAVLERLYEHgMRTPSAEQIKQITARLrehgHIEGKNVFYWFQNHKARQRQ 99
                7*****************99**************************************96 PP

2Wus_type_Homeobox114.55.4e-3739101365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ++RW+Pt+eQ+ +Le+ly++G+rtP++e+i++ita+L+e+G+ie+kNVfyWFQN+kaR+rqkq
         Do012440.1  39 NARWNPTKEQLAVLERLYEHGMRTPSAEQIKQITARLREHGHIEGKNVFYWFQNHKARQRQKQ 101
                        78***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.1135100IPR001356Homeobox domain
SMARTSM003892.7E-737104IPR001356Homeobox domain
PfamPF000465.2E-194099IPR001356Homeobox domain
SuperFamilySSF466892.67E-1340107IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-84099IPR009057Homeodomain-like
CDDcd000863.75E-841101No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MEAPQQGSSV VIDLESSGGG APVSPPLSPA SAAAAALANA RWNPTKEQLA VLERLYEHGM  60
RTPSAEQIKQ ITARLREHGH IEGKNVFYWF QNHKARQRQK QKQESFAYFT RLLRRPPPLP  120
MLFRPPGQPY PHGAGRLPVP AAPAAAPVMA TMAPPPSPVG SSRNNNGGTH VMYNRAPFYM  180
AAPQGPAANA YYHHMQQQQQ HQQQTAVMYP RMEIAQDKMI PAVAQQHQHQ HHQAGAMYQA  240
AAAPPPNSAS STPLHVVQHF PAPGADAGPS RRETLQLFPL QPSYLLPDKG LAAAAAGGAH  300
LASASASFSG ESEGPASPDN NDEAPALPFY DFFGLQSGGR
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo012440.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4902351e-119AM490235.1 Zea mays mRNA for putative wuschel homeobox protein (wox2A gene).
GenBankBT0370091e-119BT037009.1 Zea mays full-length cDNA clone ZM_BFb0151I01 mRNA, complete cds.
GenBankEU9540621e-119EU954062.1 Zea mays clone 1453569 homeobox domain containing protein mRNA, complete cds.
GenBankKJ7283841e-119KJ728384.1 Zea mays clone pUT6667 HB transcription factor (HB94) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025814413.11e-107WUSCHEL-related homeobox 5-like
TrEMBLA0A1E5VPD40.0A0A1E5VPD4_9POAL; WUSCHEL-related homeobox 2
STRINGSi004427m3e-92(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75093548
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.14e-35WUSCHEL related homeobox 2