PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do012260.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family G2-like
Protein Properties Length: 350aa    MW: 37765.6 Da    PI: 7.1046
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do012260.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.79.4e-32222277156
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                 k+r++W+peLH++Fv a++qLGG+++AtPk+i+e+m+v+gLt+++vkSHLQkYRl+
  Do012260.1 222 KARRCWSPELHRQFVTALHQLGGPQVATPKQIREVMQVDGLTNDEVKSHLQKYRLH 277
                 68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.308219279IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-28220280IPR009057Homeodomain-like
SuperFamilySSF466891.16E-16220280IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-25222277IPR006447Myb domain, plants
PfamPF002491.3E-7224275IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010092Biological Processspecification of organ identity
GO:0010629Biological Processnegative regulation of gene expression
GO:0048449Biological Processfloral organ formation
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MGLDVAEIGM GLDLGLDLRL FTARSAGGMA AAAAKGAPAG IEACIRSLEE ERRKIEVFRR  60
ELPLCVRLLA DVIEELKEEA AKRGCDLEMR ADDGDKRKWM STAQLWVDSD AKSKSEKEQR  120
NEKTSPEPKL LGGPMPIRAV PAVLPPPPPC FRRDDNAVDT VGLAGLSLLP PAAKTWPSPV  180
PAADDHRQNV TARFSATMPP SGPGLNLHAQ TQQQQQQQQA RKARRCWSPE LHRQFVTALH  240
QLGGPQVATP KQIREVMQVD GLTNDEVKSH LQKYRLHNRR SPGMAPVSQS IMLVGGGLWV  300
SQEQSSSQSG SPQGPLQFSG SGAAVSAATV GGDSSSSDED DKSDEGYSQK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-14222275154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-14222275154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-14222275154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-14222275154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00475DAPTransfer from AT4G37180Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo012260.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025792667.11e-170transcription factor HHO5-like
TrEMBLA0A1E5W5K30.0A0A1E5W5K3_9POAL; Myb family transcription factor EFM
STRINGPavir.J18103.1.p1e-168(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP181737107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.13e-31G2-like family protein