PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do012220.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GRAS
Protein Properties Length: 175aa    MW: 19103.2 Da    PI: 8.2784
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do012220.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS182.14.1e-56117349231
        GRAS  49 Laarlarsvselykalppsetsekn.sseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTg 146
                 ++arl++s+ +ly+ lpp +t+  + + +++a +++f+ +sP++kfsh+taNqaI ea+e+eervHiiD+di+qGlQWp L++ LasRp+gpp++R+Tg
  Do012220.1   1 MSARLVSSCLGLYAPLPPASTAAARlHGRVAAXFQVFNGISPFVKFSHFTANQAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGGPPRVRLTG 99 
                 579*************8888877775777888899**************************************************************** PP

        GRAS 147 vgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklv 231
                 +g+    s e+le+tg+rL++fA++lg+pfef + va++  ++++ +L v ++E +aV++ +  h+l+d ++s ++    +L+l+
  Do012220.1 100 LGA----SMEALEATGKRLSDFADTLGLPFEFCA-VAEKAGNVDPGKLGVTRREXVAVHWLH--HSLYDVTGSXSN----TLWLI 173
                 ***....***************************.7*************************9..999988988888....66666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098532.4911175IPR005202Transcription factor GRAS
PfamPF035141.4E-531173IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MSARLVSSCL GLYAPLPPAS TAAARLHGRV AAXFQVFNGI SPFVKFSHFT ANQAIQEAFE  60
REERVHIIDL DIMQGLQWPG LFHILASRPG GPPRVRLTGL GASMEALEAT GKRLSDFADT  120
LGLPFEFCAV AEKAGNVDPG KLGVTRREXV AVHWLHHSLY DVTGSXSNTL WLIQR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-241716162217GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2634570.0AF263457.1 Zea mays SCARECROW (SCR) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448913.11e-117hypothetical protein SORBIDRAFT_05g001500
SwissprotQ9FUZ71e-118SCR_MAIZE; Protein SCARECROW
TrEMBLC0P5W31e-120C0P5W3_MAIZE; Uncharacterized protein
TrEMBLC5Y3L11e-117C5Y3L1_SORBI; Putative uncharacterized protein Sb05g001500
STRINGSb05g001500.11e-116(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137138122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.17e-92GRAS family protein