PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do011892.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family HD-ZIP
Protein Properties Length: 232aa    MW: 25637.7 Da    PI: 6.404
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do011892.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.65.1e-1958111356
                 --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 k++++++eq+e Le  F+++r++ + ++ +LA++lgL+ +qV vWFqNrRa++k
  Do011892.1  58 KKRRLSDEQVEMLELSFREERKLETGRKVHLAAELGLDPKQVAVWFQNRRARHK 111
                 45589***********************************************99 PP

2HD-ZIP_I/II116.31.8e-3758148292
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  kkrrls+eqv++LE sF+ee+kLe+ rKv+la eLgl+p+qvavWFqnrRAR+k+k lE+++++Lk+a+da   ++++Le+ev +L+e+l+
   Do011892.1  58 KKRRLSDEQVEMLELSFREERKLETGRKVHLAAELGLDPKQVAVWFQNRRARHKSKLLEEEFAKLKQAHDAAILHKCHLENEVMRLKERLE 148
                  9**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.19E-1753112IPR009057Homeodomain-like
PROSITE profilePS5007116.27753113IPR001356Homeobox domain
SMARTSM003894.9E-1756117IPR001356Homeobox domain
PfamPF000462.6E-1658111IPR001356Homeobox domain
CDDcd000861.53E-1558113No hitNo description
Gene3DG3DSA:1.10.10.603.7E-1858111IPR009057Homeodomain-like
PRINTSPR000311.2E-58493IPR000047Helix-turn-helix motif
PROSITE patternPS00027088111IPR017970Homeobox, conserved site
PRINTSPR000311.2E-593109IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MEQYDGLFPS AYVDSSSSLL VPNAGAAQGE RPRARRRRRR AARCGGDGGE LDGGGDPKKR  60
RLSDEQVEML ELSFREERKL ETGRKVHLAA ELGLDPKQVA VWFQNRRARH KSKLLEEEFA  120
KLKQAHDAAI LHKCHLENEV MRLKERLEVT EEELTRLRSA GSHAVSGDGG DVMGRVVCSA  180
SPSSSFSTGT CYQQPGVGGG GDHLGDDDLL YVPDYAYADN SVVEWFSLYG LM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13039RPRARRRRRR
23442RRRRRRAAR
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo011892.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0399590.0BT039959.1 Zea mays full-length cDNA clone ZM_BFc0054M14 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958136.11e-115homeobox-leucine zipper protein HOX14
SwissprotQ7XI856e-87HOX14_ORYSJ; Homeobox-leucine zipper protein HOX14
TrEMBLA0A1E5VQE41e-169A0A1E5VQE4_9POAL; Homeobox-leucine zipper protein HOX14
STRINGSi031009m1e-115(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP200638101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.16e-34homeobox protein 40
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]