PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do011846.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family HD-ZIP
Protein Properties Length: 232aa    MW: 25689.7 Da    PI: 7.6651
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do011846.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.89.3e-1957110356
                 --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 k++++++eq + Le+ F+k+r++ ++++ +LA++lgL+ +qV vWFqNrRa++k
  Do011846.1  57 KKRRLSDEQARFLESSFRKERKLETTRKVQLAAELGLDAKQVAVWFQNRRARHK 110
                 66789***********************************************99 PP

2HD-ZIP_I/II110.89.2e-3657148293
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  kkrrls+eq+++LE+sF++e+kLe++rKv+la eLgl+++qvavWFqnrRAR+k+k +E+++++L++a+da++ +n++Le+e  +++e+l+e
   Do011846.1  57 KKRRLSDEQARFLESSFRKERKLETTRKVQLAAELGLDAKQVAVWFQNRRARHKSKLMEEEFSKLRAAHDAVVLQNCHLETELLRMKERLAE 148
                  9*************************************************************************************999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.05452112IPR001356Homeobox domain
SMARTSM003892.6E-1555116IPR001356Homeobox domain
SuperFamilySSF466894.49E-1756119IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.8E-1757110IPR009057Homeodomain-like
CDDcd000862.80E-1557112No hitNo description
PfamPF000462.9E-1657110IPR001356Homeobox domain
PRINTSPR000315.1E-68392IPR000047Helix-turn-helix motif
PROSITE patternPS00027087110IPR017970Homeobox, conserved site
PRINTSPR000315.1E-692108IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MGCEEDERLL FPSFAFPESF AEAATPGSGG EQKKARQRRR RKARAAVDGE GGDEQSKKRR  60
LSDEQARFLE SSFRKERKLE TTRKVQLAAE LGLDAKQVAV WFQNRRARHK SKLMEEEFSK  120
LRAAHDAVVL QNCHLETELL RMKERLAEAE EEKRKLIAAA AATAAGGAGA GSSSPSSSSF  180
STVTHHPAAL VGQFGVDAEE AANLTYISEY AYNSYMNMMD GYFGGGVYDH FN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13959RRKARAAVDGEGGDEQSKKRR
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo011846.1
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0431630.0BT043163.2 Zea mays full-length cDNA clone ZM_BFc0114N11 mRNA, complete cds.
GenBankEU9687900.0EU968790.1 Zea mays clone 324157 DNA binding protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025792589.11e-121homeobox-leucine zipper protein HOX12-like
SwissprotQ10QF24e-89HOX12_ORYSJ; Homeobox-leucine zipper protein HOX12
TrEMBLA0A1E5VQD91e-169A0A1E5VQD9_9POAL; Homeobox-leucine zipper protein HOX12
STRINGPavir.Ib00656.1.p1e-120(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP200638101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.17e-30homeobox protein 40
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Gao S,Fang J,Xu F,Wang W,Chu C
    Rice HOX12 Regulates Panicle Exsertion by Directly Modulating the Expression of ELONGATED UPPERMOST INTERNODE1.
    Plant Cell, 2016. 28(3): p. 680-95
    [PMID:26977084]